FK126_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FK126_ARATH
• UniProt AC: Q9LMR5
• Protein Name: F-box/kelch-repeat protein At1g15670
• Gene Name: At1g15670
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 359
• Protein Sequence: MELIPDLPETVAYECLLRSSYKQFPLMASVCKLWQREISLSDFFRHRKASGHSQELVVLSQARVDPVKELVSGNKTIPTPVYRISVLELGTGLRSELPPVPGHSNGLPLFCRLVSVGSDLVVLCGLDPVTWRTSDSVFVFSFLTSTWRVGKSMPGGPRSFFACASDSQRNVFVAGGHDEDKNAMMSALVYDVAEDRWAFLPDMGRERDECTAIFHAGKFHVIGGYSTEEQGQFSKTAESFDVTTWRWSPQGEEFLSSEMTMWPPICAAGENGDLYACCRRDLMMMKDDTWYKVGNLPADVCNVSYVAIRRSGNLVVIGSARYGEPSVGYNWDMSNSRWLKLETHDKYEGHVQAGCFLEI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
152	Phosphorylation	STWRVGKSMPGGPRS CEEECCCCCCCCCCC	25.04	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FK126_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FK126_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FK126_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PSAD1_ARATH	PSAD-1	physical	21798944
PAL1_ARATH	PAL1	physical	21798944
PAL4_ARATH	PAL4	physical	21798944
PAL2_ARATH	PAL2	physical	21798944
ARR1_ARATH	RR1	physical	23720308
ARR12_ARATH	RR12	physical	23720308

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.