UniProt ID | FK126_ARATH | |
---|---|---|
UniProt AC | Q9LMR5 | |
Protein Name | F-box/kelch-repeat protein At1g15670 | |
Gene Name | At1g15670 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 359 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MELIPDLPETVAYECLLRSSYKQFPLMASVCKLWQREISLSDFFRHRKASGHSQELVVLSQARVDPVKELVSGNKTIPTPVYRISVLELGTGLRSELPPVPGHSNGLPLFCRLVSVGSDLVVLCGLDPVTWRTSDSVFVFSFLTSTWRVGKSMPGGPRSFFACASDSQRNVFVAGGHDEDKNAMMSALVYDVAEDRWAFLPDMGRERDECTAIFHAGKFHVIGGYSTEEQGQFSKTAESFDVTTWRWSPQGEEFLSSEMTMWPPICAAGENGDLYACCRRDLMMMKDDTWYKVGNLPADVCNVSYVAIRRSGNLVVIGSARYGEPSVGYNWDMSNSRWLKLETHDKYEGHVQAGCFLEI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
152 | Phosphorylation | STWRVGKSMPGGPRS CEEECCCCCCCCCCC | 25.04 | 24894044 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FK126_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FK126_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FK126_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PSAD1_ARATH | PSAD-1 | physical | 21798944 | |
PAL1_ARATH | PAL1 | physical | 21798944 | |
PAL4_ARATH | PAL4 | physical | 21798944 | |
PAL2_ARATH | PAL2 | physical | 21798944 | |
ARR1_ARATH | RR1 | physical | 23720308 | |
ARR12_ARATH | RR12 | physical | 23720308 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...