IAA28_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IAA28_ARATH
• UniProt AC: Q9XFM0
• Protein Name: Auxin-responsive protein IAA28
• Gene Name: IAA28
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 175
• Subcellular Localization: Nucleus.
• Protein Description: Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression..
• Protein Sequence: MEEEKRLELRLAPPCHQFTSNNNINGSKQKSSTKETSFLSNNRVEVAPVVGWPPVRSSRRNLTAQLKEEMKKKESDEEKELYVKINMEGVPIGRKVNLSAYNNYQQLSHAVDQLFSKKDSWDLNRQYTLVYEDTEGDKVLVGDVPWEMFVSTVKRLHVLKTSHAFSLSPRKHGKE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
168	Phosphorylation	TSHAFSLSPRKHGKE CCCCCCCCCCCCCCC	22.81	30589143

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IAA28_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IAA28_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IAA28_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARFE_ARATH	MP	physical	22096563
ARFD_ARATH	ARF4	physical	22096563
ARFA_ARATH	ARF1	physical	22096563
ARFI_ARATH	ARF9	physical	22096563
ARFR_ARATH	ARF18	physical	22096563
TIR1L_ARATH	AFB5	physical	21734647
TIR1_ARATH	TIR1	physical	21734647
IAA18_ARATH	IAA18	physical	21734647
IAA8_ARATH	IAA8	physical	21734647
ARFS_ARATH	ARF19	physical	21734647
IAA1_ARATH	IAA1	physical	21734647
IAA3_ARATH	SHY2	physical	21734647
IAA5_ARATH	IAA5	physical	21734647
IAA16_ARATH	IAA16	physical	21734647
IAA17_ARATH	AXR3	physical	21734647
IAA20_ARATH	IAA20	physical	21734647
IAA27_ARATH	PAP2	physical	21734647
IAA31_ARATH	IAA31	physical	21734647
IAA33_ARATH	IAA33	physical	21734647
ARFG_ARATH	NPH4	physical	21734647
ARFH_ARATH	ARF8	physical	21734647

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.