dbPTM

IAA27_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IAA27_ARATH
UniProt AC	Q9ZSY8
Protein Name	Auxin-responsive protein IAA27
Gene Name	IAA27
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	305
Subcellular Localization	Nucleus.
Protein Description	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression..
Protein Sequence	MSVSVAAEHDYIGLSEFPTMEATTMSDKTKTRDNNNGLNFKATELRLGLPGSESPERVDSRFLALNKSSCPVSGAKRVFSDAINDSNKWVFSPGSTTATGDVGSGSGPRTSVVKDGKSTTFTKPAVPVKEKKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKVSMEGAPYLRKIDLKTYKSYLELSSALEKMFSCFTIGQFGSHGGCGRDGLNESRLTDLLRGSEYVVTYEDKDSDWMLVGDVPWEMFICSCKKLRIMKSSEAIGLAPRVMEKCRSRN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Phosphorylation	------MSVSVAAEH ------CCCEECEEC	24.09	28011693
4	Phosphorylation	----MSVSVAAEHDY ----CCCEECEECCC	9.95	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IAA27_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IAA27_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IAA27_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TPR3_ARATH	TPR3	physical	21798944
ARFV_ARATH	ARF22	physical	21734647
IAA1_ARATH	IAA1	physical	21734647
IAA4_ARATH	ATAUX2-11	physical	21734647
IAA5_ARATH	IAA5	physical	21734647
IAA6_ARATH	IAA6	physical	21734647
IAA8_ARATH	IAA8	physical	21734647
IAA10_ARATH	IAA10	physical	21734647
IAA9_ARATH	IAA9	physical	21734647
IAA13_ARATH	IAA13	physical	21734647
IAA16_ARATH	IAA16	physical	21734647
IAA18_ARATH	IAA18	physical	21734647
IAA17_ARATH	AXR3	physical	21734647
IAA34_ARATH	IAA34	physical	21734647
IAA31_ARATH	IAA31	physical	21734647
IAA30_ARATH	IAA30	physical	21734647
IAA27_ARATH	PAP2	physical	21734647
ARFE_ARATH	MP	physical	21734647
ARFF_ARATH	ARF6	physical	21734647
ARFH_ARATH	ARF8	physical	21734647

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IAA27_ARATH

Related Literatures of Post-Translational Modification