dbPTM

IAA13_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IAA13_ARATH
UniProt AC	Q38831
Protein Name	Auxin-responsive protein IAA13
Gene Name	IAA13
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	247
Subcellular Localization	Nucleus.
Protein Description	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression..
Protein Sequence	MITELEMGKGESELELGLGLSLGGGTAAKIGKSGGGGAWGERGRLLTAKDFPSVGSKRAADSASHAGSSPPRSSSQVVGWPPIGSHRMNSLVNNQATKSAREEEEAGKKKVKDDEPKDVTKKVNGKVQVGFIKVNMDGVAIGRKVDLNAHSSYENLAQTLEDMFFRTNPGTVGLTSQFTKPLRLLDGSSEFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRVMKTSEANGLAARNQEPNERQRKQPV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
68	Phosphorylation	DSASHAGSSPPRSSS CCCCCCCCCCCCCCC	40.22	25561503
69	Phosphorylation	SASHAGSSPPRSSSQ CCCCCCCCCCCCCCC	37.70	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IAA13_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IAA13_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IAA13_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARFE_ARATH	MP	physical	22096563
IAA3_ARATH	SHY2	physical	21734647
IAA9_ARATH	IAA9	physical	21734647
IAA12_ARATH	IAA12	physical	21734647
IAA34_ARATH	IAA34	physical	21734647
IAA30_ARATH	IAA30	physical	21734647
IAA19_ARATH	IAA19	physical	21734647
IAA17_ARATH	AXR3	physical	21734647
IAA16_ARATH	IAA16	physical	21734647
ARFE_ARATH	MP	physical	21734647
ARFF_ARATH	ARF6	physical	21734647
ARFG_ARATH	NPH4	physical	21734647
ARFH_ARATH	ARF8	physical	21734647
IAA13_ARATH	IAA13	physical	14729917

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IAA13_ARATH

Related Literatures of Post-Translational Modification