IAA12_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IAA12_ARATH
• UniProt AC: Q38830
• Protein Name: Auxin-responsive protein IAA12
• Gene Name: IAA12
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 239
• Subcellular Localization: Nucleus.
• Protein Description: Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression..
• Protein Sequence: MRGVSELEVGKSNLPAESELELGLGLSLGGGAWKERGRILTAKDFPSVGSKRSAESSSHQGASPPRSSQVVGWPPIGLHRMNSLVNNQAMKAARAEEGDGEKKVVKNDELKDVSMKVNPKVQGLGFVKVNMDGVGIGRKVDMRAHSSYENLAQTLEEMFFGMTGTTCREKVKPLRLLDGSSDFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRIMGTSEASGLAPRRQEQKDRQRNNPV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
63	Phosphorylation	SSSHQGASPPRSSQV CCCCCCCCCCCHHCC	42.11	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	TIR1	Q570C0	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IAA12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IAA12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TPL_ARATH	TPL	physical	18258861
ARFG_ARATH	NPH4	physical	14973283
ARFE_ARATH	MP	physical	14973283
ARFE_ARATH	MP	physical	12101120
IAA12_ARATH	IAA12	physical	12101120
TIR1_ARATH	TIR1	physical	15992545
GRH1_ARATH	GRH1	physical	15992545
AFB3_ARATH	AFB3	physical	15992545
UBQ10_ARATH	UBQ10	physical	19309453
ARFE_ARATH	MP	physical	22096563
IAA18_ARATH	IAA18	physical	21734647
IAA3_ARATH	SHY2	physical	21734647
IAA8_ARATH	IAA8	physical	21734647
IAA9_ARATH	IAA9	physical	21734647
IAA12_ARATH	IAA12	physical	21734647
IAA31_ARATH	IAA31	physical	21734647
IAA30_ARATH	IAA30	physical	21734647
IAA28_ARATH	IAA28	physical	21734647
IAA20_ARATH	IAA20	physical	21734647
IAA17_ARATH	AXR3	physical	21734647
IAA16_ARATH	IAA16	physical	21734647
ARFG_ARATH	NPH4	physical	21734647
ARFI_ARATH	ARF9	physical	21734647
ARFE_ARATH	MP	physical	22349732
IAA12_ARATH	IAA12	physical	24710426
ARFE_ARATH	MP	physical	24710426

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.