IAA3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IAA3_ARATH
• UniProt AC: Q38822
• Protein Name: Auxin-responsive protein IAA3
• Gene Name: IAA3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 189
• Subcellular Localization: Nucleus.
• Protein Description: Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Plays a central role in auxin regulation of root growth, in gravitropism, and in lateral root formation. [PubMed: 9895319 Regulated by an auxin-induced protein turnover]
• Protein Sequence: MDEFVNLKETELRLGLPGTDNVCEAKERVSCCNNNNKRVLSTDTEKEIESSSRKTETSPPRKAQIVGWPPVRSYRKNNIQSKKNESEHEGQGIYVKVSMDGAPYLRKIDLSCYKGYSELLKALEVMFKFSVGEYFERDGYKGSDFVPTYEDKDGDWMLIGDVPWEMFICTCKRLRIMKGSEAKGLGCGV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
117	Phosphorylation	LSCYKGYSELLKALE CHHHCCHHHHHHHHH	30.36	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	TIR1	Q570C0	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IAA3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IAA3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TIR1_ARATH	TIR1	physical	14617065
PHYB_ARATH	PHYB	physical	14617065
UBQ10_ARATH	UBQ10	physical	19309453
GRS15_ARATH	GRX4	physical	21798944
IAA11_ARATH	IAA11	physical	21798944
IAA18_ARATH	IAA18	physical	21798944
IAA7_ARATH	IAA7	physical	21798944
IAA1_ARATH	IAA1	physical	21798944
GRS16_ARATH	CXIP2	physical	21798944
TPR3_ARATH	TPR3	physical	21798944
TIR1_ARATH	TIR1	physical	22171938
AFB2_ARATH	AFB2	physical	22171938
IAA2_ARATH	IAA2	physical	21734647
IAA8_ARATH	IAA8	physical	21734647
IAA5_ARATH	IAA5	physical	21734647
IAA4_ARATH	ATAUX2-11	physical	21734647
IAA3_ARATH	SHY2	physical	21734647
IAA34_ARATH	IAA34	physical	21734647
IAA27_ARATH	PAP2	physical	21734647
IAA20_ARATH	IAA20	physical	21734647
IAA19_ARATH	IAA19	physical	21734647
IAA18_ARATH	IAA18	physical	21734647
IAA17_ARATH	AXR3	physical	21734647
ARFI_ARATH	ARF9	physical	21734647

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.