| UniProt ID | AFB2_ARATH | |
|---|---|---|
| UniProt AC | Q9LW29 | |
| Protein Name | Protein AUXIN SIGNALING F-BOX 2 | |
| Gene Name | AFB2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 575 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Confers sensitivity to the virulent bacterial pathogen P.syringae (By similarity). Auxin receptor that mediates Aux/IAA proteins proteasomal degradation and auxin-regulated transcription. Involved in embryogenesis regulation by auxin.. | |
| Protein Sequence | MNYFPDEVIEHVFDFVTSHKDRNAISLVCKSWYKIERYSRQKVFIGNCYAINPERLLRRFPCLKSLTLKGKPHFADFNLVPHEWGGFVLPWIEALARSRVGLEELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFTTDGLASIAANCRHLRDLDLQENEIDDHRGQWLSCFPDTCTTLVTLNFACLEGETNLVALERLVARSPNLKSLKLNRAVPLDALARLMACAPQIVDLGVGSYENDPDSESYLKLMAVIKKCTSLRSLSGFLEAAPHCLSAFHPICHNLTSLNLSYAAEIHGSHLIKLIQHCKKLQRLWILDSIGDKGLEVVASTCKELQELRVFPSDLLGGGNTAVTEEGLVAISAGCPKLHSILYFCQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLSGLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLADVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKLYLYRTVVGTRMDAPPFVWIL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of AFB2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AFB2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AFB2_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AFB2_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TCP14_ARATH | TCP14 | physical | 21798944 | |
| IAA7_ARATH | IAA7 | physical | 22171938 | |
| IAA29_ARATH | IAA29 | physical | 22466420 | |
| IAA28_ARATH | IAA28 | physical | 22466420 | |
| IAA31_ARATH | IAA31 | physical | 22466420 | |
| IAA5_ARATH | IAA5 | physical | 22466420 | |
| IAA7_ARATH | IAA7 | physical | 22466420 | |
| IAA8_ARATH | IAA8 | physical | 22466420 | |
| IAA3_ARATH | SHY2 | physical | 22466420 | |
| IAA12_ARATH | IAA12 | physical | 22466420 | |
| SKP1B_ARATH | ASK2 | physical | 23166809 | |
| ASK11_ARATH | SK11 | physical | 23166809 | |
| ASK12_ARATH | SK12 | physical | 23166809 | |
| ASK13_ARATH | SK13 | physical | 23166809 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
