| UniProt ID | TCP14_ARATH | |
|---|---|---|
| UniProt AC | Q93Z00 | |
| Protein Name | Transcription factor TCP14 | |
| Gene Name | TCP14 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 489 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | ||
| Protein Sequence | MQKPTSSILNVIMDGGDSVGGGGGDDHHRHLHHHHRPTFPFQLLGKHDPDDNHQQQPSPSSSSSLFSLHQHQQLSQSQPQSQSQKSQPQTTQKELLQTQEESAVVAAKKPPLKRASTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPSVIAATGTGTIPANFTSLNISLRSSGSSMSLPSHFRSAASTFSPNNIFSPAMLQQQQQQQRGGGVGFHHPHLQGRAPTSSLFPGIDNFTPTTSFLNFHNPTKQEGDQDSEELNSEKKRRIQTTSDLHQQQQQHQHDQIGGYTLQSSNSGSTATAAAAQQIPGNFWMVAAAAAAGGGGGNNNQTGGLMTASIGTGGGGGEPVWTFPSINTAAAALYRSGVSGVPSGAVSSGLHFMNFAAPMAFLTGQQQLATTSNHEINEDSNNNEGGRSDGGGDHHNTQRHHHHQQQHHHNILSGLNQYGRQVSGDSQASGSLGGGDEEDQQD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 58 | Phosphorylation | DNHQQQPSPSSSSSL CCCCCCCCCCCCHHH | 32.83 | 27545962 | |
| 60 | Phosphorylation | HQQQPSPSSSSSLFS CCCCCCCCCCHHHHH | 47.38 | 27545962 | |
| 61 | Phosphorylation | QQQPSPSSSSSLFSL CCCCCCCCCHHHHHH | 37.31 | 27545962 | |
| 62 | Phosphorylation | QQPSPSSSSSLFSLH CCCCCCCCHHHHHHH | 28.43 | 27545962 | |
| 63 | Phosphorylation | QPSPSSSSSLFSLHQ CCCCCCCHHHHHHHH | 32.77 | 27545962 | |
| 64 | Phosphorylation | PSPSSSSSLFSLHQH CCCCCCHHHHHHHHH | 35.07 | 27545962 | |
| 67 | Phosphorylation | SSSSSLFSLHQHQQL CCCHHHHHHHHHHHH | 30.18 | 27545962 | |
| 75 | Phosphorylation | LHQHQQLSQSQPQSQ HHHHHHHHHCCCCCH | 24.37 | 27545962 | |
| 77 | Phosphorylation | QHQQLSQSQPQSQSQ HHHHHHHCCCCCHHH | 40.21 | 27545962 | |
| 81 | Phosphorylation | LSQSQPQSQSQKSQP HHHCCCCCHHHCCCC | 38.18 | 27545962 | |
| 83 | Phosphorylation | QSQPQSQSQKSQPQT HCCCCCHHHCCCCCH | 44.84 | 27545962 | |
| 190 | Phosphorylation | SLNISLRSSGSSMSL EEEEEEECCCCCCCC | 44.32 | 25561503 | |
| 191 | Phosphorylation | LNISLRSSGSSMSLP EEEEEECCCCCCCCC | 35.94 | 25561503 | |
| 193 | Phosphorylation | ISLRSSGSSMSLPSH EEEECCCCCCCCCHH | 25.47 | 25561503 | |
| 194 | Phosphorylation | SLRSSGSSMSLPSHF EEECCCCCCCCCHHH | 18.86 | 25561503 | |
| 196 | Phosphorylation | RSSGSSMSLPSHFRS ECCCCCCCCCHHHHH | 38.79 | 25561503 | |
| 275 | Phosphorylation | KQEGDQDSEELNSEK CCCCCCCHHHHHHHH | 27.60 | 30407730 | |
| 478 | Phosphorylation | GDSQASGSLGGGDEE CCCCCCCCCCCCCHH | 22.73 | 25561503 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TCP14_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TCP14_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TCP14_ARATH !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
