UniProt ID | TCP14_ARATH | |
---|---|---|
UniProt AC | Q93Z00 | |
Protein Name | Transcription factor TCP14 | |
Gene Name | TCP14 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 489 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MQKPTSSILNVIMDGGDSVGGGGGDDHHRHLHHHHRPTFPFQLLGKHDPDDNHQQQPSPSSSSSLFSLHQHQQLSQSQPQSQSQKSQPQTTQKELLQTQEESAVVAAKKPPLKRASTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPSVIAATGTGTIPANFTSLNISLRSSGSSMSLPSHFRSAASTFSPNNIFSPAMLQQQQQQQRGGGVGFHHPHLQGRAPTSSLFPGIDNFTPTTSFLNFHNPTKQEGDQDSEELNSEKKRRIQTTSDLHQQQQQHQHDQIGGYTLQSSNSGSTATAAAAQQIPGNFWMVAAAAAAGGGGGNNNQTGGLMTASIGTGGGGGEPVWTFPSINTAAAALYRSGVSGVPSGAVSSGLHFMNFAAPMAFLTGQQQLATTSNHEINEDSNNNEGGRSDGGGDHHNTQRHHHHQQQHHHNILSGLNQYGRQVSGDSQASGSLGGGDEEDQQD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | Phosphorylation | DNHQQQPSPSSSSSL CCCCCCCCCCCCHHH | 32.83 | 27545962 | |
60 | Phosphorylation | HQQQPSPSSSSSLFS CCCCCCCCCCHHHHH | 47.38 | 27545962 | |
61 | Phosphorylation | QQQPSPSSSSSLFSL CCCCCCCCCHHHHHH | 37.31 | 27545962 | |
62 | Phosphorylation | QQPSPSSSSSLFSLH CCCCCCCCHHHHHHH | 28.43 | 27545962 | |
63 | Phosphorylation | QPSPSSSSSLFSLHQ CCCCCCCHHHHHHHH | 32.77 | 27545962 | |
64 | Phosphorylation | PSPSSSSSLFSLHQH CCCCCCHHHHHHHHH | 35.07 | 27545962 | |
67 | Phosphorylation | SSSSSLFSLHQHQQL CCCHHHHHHHHHHHH | 30.18 | 27545962 | |
75 | Phosphorylation | LHQHQQLSQSQPQSQ HHHHHHHHHCCCCCH | 24.37 | 27545962 | |
77 | Phosphorylation | QHQQLSQSQPQSQSQ HHHHHHHCCCCCHHH | 40.21 | 27545962 | |
81 | Phosphorylation | LSQSQPQSQSQKSQP HHHCCCCCHHHCCCC | 38.18 | 27545962 | |
83 | Phosphorylation | QSQPQSQSQKSQPQT HCCCCCHHHCCCCCH | 44.84 | 27545962 | |
190 | Phosphorylation | SLNISLRSSGSSMSL EEEEEEECCCCCCCC | 44.32 | 25561503 | |
191 | Phosphorylation | LNISLRSSGSSMSLP EEEEEECCCCCCCCC | 35.94 | 25561503 | |
193 | Phosphorylation | ISLRSSGSSMSLPSH EEEECCCCCCCCCHH | 25.47 | 25561503 | |
194 | Phosphorylation | SLRSSGSSMSLPSHF EEECCCCCCCCCHHH | 18.86 | 25561503 | |
196 | Phosphorylation | RSSGSSMSLPSHFRS ECCCCCCCCCHHHHH | 38.79 | 25561503 | |
275 | Phosphorylation | KQEGDQDSEELNSEK CCCCCCCHHHHHHHH | 27.60 | 30407730 | |
478 | Phosphorylation | GDSQASGSLGGGDEE CCCCCCCCCCCCCHH | 22.73 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TCP14_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TCP14_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TCP14_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...