CML41_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CML41_ARATH
• UniProt AC: Q8L3R2
• Protein Name: Probable calcium-binding protein CML41
• Gene Name: CML41
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 205
• Protein Description: Potential calcium sensor..
• Protein Sequence: MATQKEKPSSNSFKWFSTKTLKLNLSFQNRRRSPKSNSSSTLNSPRSNSDDNNNIKSHQASKEELRQVFSHFDSDGDGKISAFELRHYFGSVGEYISHEAAQEAINEVDTDADGSLGFEDFVGLMTRRDLYGDGEVDGDGELKTAFEMFEVEKGSGCITPKGLQKMLVKLGESRTYGECEAMIKFYDIDGNGILDFHEFRQMMTV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	KEKPSSNSFKWFSTK CCCCCCCCCCEEECC	30.10	25561503
26	Phosphorylation	KTLKLNLSFQNRRRS CEEEEECEECCCCCC	24.58	27545962
36	Phosphorylation	NRRRSPKSNSSSTLN CCCCCCCCCCCCCCC	45.38	25561503
38	Phosphorylation	RRSPKSNSSSTLNSP CCCCCCCCCCCCCCC	32.53	25561503
39	Phosphorylation	RSPKSNSSSTLNSPR CCCCCCCCCCCCCCC	31.43	25561503
40	Phosphorylation	SPKSNSSSTLNSPRS CCCCCCCCCCCCCCC	36.41	25561503
41	Phosphorylation	PKSNSSSTLNSPRSN CCCCCCCCCCCCCCC	31.72	25561503
44	Phosphorylation	NSSSTLNSPRSNSDD CCCCCCCCCCCCCCC	25.46	28419593
159	Phosphorylation	EKGSGCITPKGLQKM CCCCCCCCCHHHHHH	24.03	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CML41_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CML41_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CML41_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of CML41_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.