UniProt ID | CML41_ARATH | |
---|---|---|
UniProt AC | Q8L3R2 | |
Protein Name | Probable calcium-binding protein CML41 | |
Gene Name | CML41 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 205 | |
Subcellular Localization | ||
Protein Description | Potential calcium sensor.. | |
Protein Sequence | MATQKEKPSSNSFKWFSTKTLKLNLSFQNRRRSPKSNSSSTLNSPRSNSDDNNNIKSHQASKEELRQVFSHFDSDGDGKISAFELRHYFGSVGEYISHEAAQEAINEVDTDADGSLGFEDFVGLMTRRDLYGDGEVDGDGELKTAFEMFEVEKGSGCITPKGLQKMLVKLGESRTYGECEAMIKFYDIDGNGILDFHEFRQMMTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | KEKPSSNSFKWFSTK CCCCCCCCCCEEECC | 30.10 | 25561503 | |
26 | Phosphorylation | KTLKLNLSFQNRRRS CEEEEECEECCCCCC | 24.58 | 27545962 | |
36 | Phosphorylation | NRRRSPKSNSSSTLN CCCCCCCCCCCCCCC | 45.38 | 25561503 | |
38 | Phosphorylation | RRSPKSNSSSTLNSP CCCCCCCCCCCCCCC | 32.53 | 25561503 | |
39 | Phosphorylation | RSPKSNSSSTLNSPR CCCCCCCCCCCCCCC | 31.43 | 25561503 | |
40 | Phosphorylation | SPKSNSSSTLNSPRS CCCCCCCCCCCCCCC | 36.41 | 25561503 | |
41 | Phosphorylation | PKSNSSSTLNSPRSN CCCCCCCCCCCCCCC | 31.72 | 25561503 | |
44 | Phosphorylation | NSSSTLNSPRSNSDD CCCCCCCCCCCCCCC | 25.46 | 28419593 | |
159 | Phosphorylation | EKGSGCITPKGLQKM CCCCCCCCCHHHHHH | 24.03 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CML41_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CML41_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CML41_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CML41_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...