TCP19_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TCP19_ARATH
• UniProt AC: Q9LT89
• Protein Name: Transcription factor TCP19
• Gene Name: TCP19
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 293
• Subcellular Localization: Nucleus .
• Protein Sequence: MESNHEGNAIQVIDQVTTMTHLSDPNPKTKPGMMLMKQEDGYLQPVKTKPAPKRPTSKDRHTKVEGRGRRIRMPAGCAARVFQLTRELGHKSDGETIRWLLERAEPAIIEATGTGTVPAIAVSVNGTLKIPTSSPVLNDGGRDGDGDLIKKRRKRNCTSDFVDVNDSCHSSVTSGLAPITASNYGVNILNVNTQGFVPFWPMGMGTAFVTGGPDQMGQMWAIPTVATAPFLNVGARPVSSYVSNASDAEAEMETSGGGTTQPLRDFSLEIYDKRELQFLGGSGNSSPSSCHET

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
286	Phosphorylation	LGGSGNSSPSSCHET CCCCCCCCCCCCCCC	32.57	27531888

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TCP19_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TCP19_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TCP19_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDF1_ARATH	CDF1	physical	21798944
CDKE1_ARATH	CDKE;1	physical	21798944
TCP20_ARATH	TCP20	physical	24129704
TCP23_ARATH	AT1G35560	physical	24129704
TCP21_ARATH	AT5G08330	physical	24129704
TCP8_ARATH	AT1G58100	physical	24129704
TCP24_ARATH	TCP24	physical	24129704
TCP4_ARATH	TCP4	physical	24129704
TCP3_ARATH	TCP3	physical	24129704
TCP2_ARATH	TCP2	physical	24129704
TCP5_ARATH	TCP5	physical	24129704
WRK28_ARATH	WRKY28	physical	25702611

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.