UniProt ID | TCP20_ARATH | |
---|---|---|
UniProt AC | Q9LSD5 | |
Protein Name | Transcription factor TCP20 | |
Gene Name | TCP20 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 314 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes.. | |
Protein Sequence | MDPKNLNRHQVPNFLNPPPPPRNQGLVDDDAASAVVSDENRKPTTEIKDFQIVVSASDKEPNKKSQNQNQLGPKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGSGTIPASALASSAATSNHHQGGSLTAGLMISHDLDGGSSSSGRPLNWGIGGGEGVSRSSLPTGLWPNVAGFGSGVPTTGLMSEGAGYRIGFPGFDFPGVGHMSFASILGGNHNQMPGLELGLSQEGNVGVLNPQSFTQIYQQMGQAQAQAQGRVLHHMHHNHEEHQQESGEKDDSQGSGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of TCP20_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TCP20_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TCP20_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TCP20_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TCP23_ARATH | AT1G35560 | physical | 24129704 | |
TCP21_ARATH | AT5G08330 | physical | 24129704 | |
TCP8_ARATH | AT1G58100 | physical | 24129704 | |
TCP24_ARATH | TCP24 | physical | 24129704 | |
TCP4_ARATH | TCP4 | physical | 24129704 | |
TCP5_ARATH | TCP5 | physical | 24129704 | |
TCP3_ARATH | TCP3 | physical | 24129704 | |
WRK28_ARATH | WRKY28 | physical | 25702611 | |
NAC19_ARATH | NAC019 | physical | 25702611 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...