TCP20_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TCP20_ARATH
• UniProt AC: Q9LSD5
• Protein Name: Transcription factor TCP20
• Gene Name: TCP20
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 314
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes..
• Protein Sequence: MDPKNLNRHQVPNFLNPPPPPRNQGLVDDDAASAVVSDENRKPTTEIKDFQIVVSASDKEPNKKSQNQNQLGPKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGSGTIPASALASSAATSNHHQGGSLTAGLMISHDLDGGSSSSGRPLNWGIGGGEGVSRSSLPTGLWPNVAGFGSGVPTTGLMSEGAGYRIGFPGFDFPGVGHMSFASILGGNHNQMPGLELGLSQEGNVGVLNPQSFTQIYQQMGQAQAQAQGRVLHHMHHNHEEHQQESGEKDDSQGSGR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TCP20_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TCP20_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TCP20_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TCP20_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TCP23_ARATH	AT1G35560	physical	24129704
TCP21_ARATH	AT5G08330	physical	24129704
TCP8_ARATH	AT1G58100	physical	24129704
TCP24_ARATH	TCP24	physical	24129704
TCP4_ARATH	TCP4	physical	24129704
TCP5_ARATH	TCP5	physical	24129704
TCP3_ARATH	TCP3	physical	24129704
WRK28_ARATH	WRKY28	physical	25702611
NAC19_ARATH	NAC019	physical	25702611

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.