dbPTM

TCP15_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TCP15_ARATH
UniProt AC	Q9C9L2
Protein Name	Transcription factor TCP15
Gene Name	TCP15
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	325
Subcellular Localization	Nucleus .
Protein Description
Protein Sequence	MDPDPDHNHRPNFPLQLLDSSTSSSSTSLAIISTTSEPNSEPKKPPPKRTSTKDRHTKVEGRGRRIRMPAMCAARVFQLTRELGHKSDGETIEWLLQQAEPAVIAATGTGTIPANFTSLNISLRSSRSSLSAAHLRTTPSSYYFHSPHQSMTHHLQHQHQVRPKNESHSSSSSSSQLLDHNQMGNYLVQSTAGSLPTSQSPATAPFWSSGDNTQNLWAFNINPHHSGVVAGDVYNPNSGGSGGGSGVHLMNFAAPIALFSGQPLASGYGGGGGGGGEHSHYGVLAALNAAYRPVAETGNHNNNQQNRDGDHHHNHQEDGSTSHHS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
128	Phosphorylation	ISLRSSRSSLSAAHL EEECCCCCCCCHHHC	37.26	25561503
129	Phosphorylation	SLRSSRSSLSAAHLR EECCCCCCCCHHHCC	25.82	29654922
131	Phosphorylation	RSSRSSLSAAHLRTT CCCCCCCCHHHCCCC	25.92	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TCP15_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TCP15_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TCP15_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PILR1_ARATH	PRR1	physical	21183706
APRR5_ARATH	PRR5	physical	21183706
RBS2B_ARATH	AT5G38420	physical	21798944
RH11_ARATH	AT3G58510	physical	21798944
MPK3_ARATH	MPK3	physical	21798944
FRL3_ARATH	AT5G48385	physical	21798944
HSD1A_ARATH	HSD1	physical	21798944
HSD1B_ARATH	HSD1	physical	21798944
SC13B_ARATH	AT2G30050	physical	21798944
MOS1_ARATH	MOS1	physical	21798944
SODF2_ARATH	FSD2	physical	21798944
PLP3B_ARATH	PLP3b	physical	21798944
PUB14_ARATH	PUB14	physical	21798944
FQRL2_ARATH	AT4G36750	physical	21798944
TTL_ARATH	AT4G24900	physical	21798944
THOC6_ARATH	DWA1	physical	21798944
BH047_ARATH	PYE	physical	21798944
PIST_ARATH	PI	physical	21798944
SPY_ARATH	SPY	physical	22267487
TCP23_ARATH	AT1G35560	physical	24129704
TCP20_ARATH	TCP20	physical	24129704
TCP8_ARATH	AT1G58100	physical	24129704
TCP19_ARATH	AT5G51910	physical	24129704
TCP21_ARATH	AT5G08330	physical	24129704
TCP24_ARATH	TCP24	physical	24129704
TCP17_ARATH	TCP17	physical	24129704
TCP2_ARATH	TCP2	physical	24129704
TCP4_ARATH	TCP4	physical	24129704
TCP5_ARATH	TCP5	physical	24129704
TCP3_ARATH	TCP3	physical	24129704
DA1_ARATH	DA1	physical	25757472
DAR1_ARATH	AT4G36860	physical	25757472
DAR2_ARATH	DAR2	physical	25757472
TCP15_ARATH	AT1G69690	physical	24689742

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TCP15_ARATH

Related Literatures of Post-Translational Modification