dbPTM

TCP17_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TCP17_ARATH
UniProt AC	Q9LEZ9
Protein Name	Transcription factor TCP17
Gene Name	TCP17
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	242
Subcellular Localization	Nucleus .
Protein Description	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment. [PubMed: 25378179]
Protein Sequence	MGIKKEDQKSSLSLLTQRWNNPRIVRVSRAFGGKDRHSKVCTVRGLRDRRIRLSVMTAIQVYDLQERLGLSQPSKVIDWLLEVAKNDVDLLPPLQFPPGFHQLNPNLTGLGESFPGVFDLGRTQREALDLEKRKWVNLDHVFDHIDHHNHFSNSIQSNKLYFPTITSSSSSYHYNLGHLQQSLLDQSGNVTVAFSNNYNNNNLNPPAAETMSSLFPTRYPSFLGGGQLQLFSSTSSQPDHIE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of TCP17_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TCP17_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TCP17_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TCP17_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TCP5_ARATH	TCP5	physical	24129704
TCP24_ARATH	TCP24	physical	24129704
TCP2_ARATH	TCP2	physical	24129704
TCP4_ARATH	TCP4	physical	24129704
TCP3_ARATH	TCP3	physical	24129704
TCP20_ARATH	TCP20	physical	24129704
TCP19_ARATH	AT5G51910	physical	24129704
TCP21_ARATH	AT5G08330	physical	24129704
TCP23_ARATH	AT1G35560	physical	24129704
TCP8_ARATH	AT1G58100	physical	24129704

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TCP17_ARATH

Related Literatures of Post-Translational Modification