BH047_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BH047_ARATH
• UniProt AC: Q9SN74
• Protein Name: Transcription factor bHLH47
• Gene Name: BHLH47
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 240
• Subcellular Localization: Nucleus .
• Protein Sequence: MVSKTPSTSSDEANATADERCRKGKVPKRINKAVRERLKREHLNELFIELADTLELNQQNSGKASILCEATRFLKDVFGQIESLRKEHASLLSESSYVTTEKNELKEETSVLETEISKLQNEIEARANQSKPDLNTSPAPEYHHHHYQQQHPERVSQFPGLPIFQGPGFQQSATTLHPPATVLVLPIQPDPQTQDISEMTQAQQPLMFNSSNVSKPCPRYASAADSWSSRLLGERLKASE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of BH047_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BH047_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BH047_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BH047_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UNE12_ARATH	UNE12	physical	21798944
TCP21_ARATH	AT5G08330	physical	21798944
SKI34_ARATH	AT5G65495	physical	21798944
TCP19_ARATH	AT5G51910	physical	21798944
HY5_ARATH	HY5	physical	19802365
ILR3_ARATH	ILR3	physical	25452667
BH115_ARATH	bHLH115	physical	25452667
BH104_ARATH	bHLH104	physical	25452667

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.