BH104_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BH104_ARATH
• UniProt AC: Q8L467
• Protein Name: Transcription factor bHLH104
• Gene Name: BHLH104
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 283
• Subcellular Localization: Nucleus .
• Protein Sequence: MYPSLDDDFVSDLFCFDQSNGAELDDYTQFGVNLQTDQEDTFPDFVSYGVNLQQEPDEVFSIGASQLDLSSYNGVLSLEPEQVGQQDCEVVQEEEVEINSGSSGGAVKEEQEHLDDDCSRKRARTGSCSRGGGTKACRERLRREKLNERFMDLSSVLEPGRTPKTDKPAILDDAIRILNQLRDEALKLEETNQKLLEEIKSLKAEKNELREEKLVLKADKEKTEQQLKSMTAPSSGFIPHIPAAFNHNKMAVYPSYGYMPMWHYMPQSVRDTSRDQELRPPAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
154	Phosphorylation	NERFMDLSSVLEPGR HHHHCCHHHHCCCCC	17.71	19880383
155	Phosphorylation	ERFMDLSSVLEPGRT HHHCCHHHHCCCCCC	37.71	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BH104_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BH104_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BH104_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ILR3_ARATH	ILR3	physical	25794933
BH115_ARATH	bHLH115	physical	25794933

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.