PILR1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PILR1_ARATH
• UniProt AC: Q9FVQ6
• Protein Name: Pinoresinol reductase 1
• Gene Name: PRR1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 317
• Protein Description: Reductase involved in lignan biosynthesis. Unlike conventional pinoresinol reductases that can reduce both pinoresinol and lariciresinol, PRR1 shows a strict substrate preference toward pinoresinol. Active on both (+) and (-)-pinoresinol. Abstracts the 4R-hydride from the NADPH cofactor during catalysis..
• Protein Sequence: MGESKRTEKTRVLVVGATGYIGKRIVRACLAEGHETYVLQRPEIGLEIEKVQLFLSFKKLGARIVEGSFSDHQSLVSAVKLVDVVVSAMSGVHFRSHNILVQLKLVEAIKEAGNVKRFLPSEFGMDPPRMGHALPPGRETFDQKMEVRQAIEAAGIPYTYVVGACFAAYFAGNLSQMVTLLPPKEKVNIYGDGNVKVVFADEDDIAKYTAKTLNDPRTLNKTVNIRPPDNVLTQLELVQIWEKLTGKELEKTNIAAQDFLANIEQMEIPHQAGIGHFYHIFYEGCLTDHEVGEDEEASSLYPDVKYKRMDDYLRMFL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PILR1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PILR1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PILR1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PILR1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TCP2_ARATH	TCP2	physical	21183706
TCP11_ARATH	AT2G37000	physical	21183706
PURU1_ARATH	AT5G47435	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.