| UniProt ID | TCP11_ARATH | |
|---|---|---|
| UniProt AC | Q9SJK7 | |
| Protein Name | Transcription factor TCP11 | |
| Gene Name | TCP11 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 188 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | ||
| Protein Sequence | MIFQNVCRNESNFNAIASESRSQTQFGVSKSSSSGGGCISARTKDRHTKVNGRSRRVTMPALAAARIFQLTRELGHKTEGETIEWLLSQAEPSIIAATGYGTKLISNWVDVAADDSSSSSSMTSPQTQTQTPQSPSCRLDLCQPIGIQYPVNGYSHMPFTAMLLEPMTTTAESEVEIAEEEERRRRHH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of TCP11_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TCP11_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TCP11_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TCP11_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LHY_ARATH | LHY | physical | 21183706 | |
| CCA1_ARATH | CCA1 | physical | 21183706 | |
| PILR1_ARATH | PRR1 | physical | 21183706 | |
| APRR3_ARATH | PRR3 | physical | 21183706 | |
| APRR5_ARATH | PRR5 | physical | 21183706 | |
| TCP19_ARATH | AT5G51910 | physical | 24129704 | |
| TCP20_ARATH | TCP20 | physical | 24129704 | |
| TCP23_ARATH | AT1G35560 | physical | 24129704 | |
| TCP24_ARATH | TCP24 | physical | 24129704 | |
| TCP13_ARATH | PTF1 | physical | 24129704 | |
| TCP17_ARATH | TCP17 | physical | 24129704 | |
| TCP14_ARATH | TCP14 | physical | 24129704 | |
| TCP21_ARATH | AT5G08330 | physical | 24129704 | |
| TCP8_ARATH | AT1G58100 | physical | 24129704 | |
| TCP15_ARATH | AT1G69690 | physical | 24129704 | |
| TCP3_ARATH | TCP3 | physical | 24129704 | |
| TCP4_ARATH | TCP4 | physical | 24129704 | |
| TCP2_ARATH | TCP2 | physical | 24129704 | |
| TCP5_ARATH | TCP5 | physical | 24129704 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
