dbPTM

CCA1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CCA1_ARATH
UniProt AC	P92973
Protein Name	Protein CCA1 {ECO:0000303\|PubMed:9144958}
Gene Name	CCA1 {ECO:0000303\|PubMed:9144958}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	608
Subcellular Localization	Nucleus . Moves into the nucleus very soo after translation. This translocation is unaffected by light and dark.
Protein Description	Transcription factor involved in the circadian clock and in the phytochrome regulation. Binds to the promoter regions of APRR1/TOC1 and TCP21/CHE to repress their transcription. Binds to the promoter regions of CAB2A and CAB2B to promote their transcription. Represses both LHY and itself..
Protein Sequence	METNSSGEDLVIKTRKPYTITKQRERWTEEEHNRFIEALRLYGRAWQKIEEHVATKTAVQIRSHAQKFFSKVEKEAEAKGVAMGQALDIAIPPPRPKRKPNNPYPRKTGSGTILMSKTGVNDGKESLGSEKVSHPEMANEDRQQSKPEEKTLQEDNCSDCFTHQYLSAASSMNKSCIETSNASTFREFLPSREEGSQNNRVRKESNSDLNAKSLENGNEQGPQTYPMHIPVLVPLGSSITSSLSHPPSEPDSHPHTVAGDYQSFPNHIMSTLLQTPALYTAATFASSFWPPDSSGGSPVPGNSPPNLAAMAAATVAAASAWWAANGLLPLCAPLSSGGFTSHPPSTFGPSCDVEYTKASTLQHGSVQSREQEHSEASKARSSLDSEDVENKSKPVCHEQPSATPESDAKGSDGAGDRKQVDRSSCGSNTPSSSDDVEADASERQEDGTNGEVKETNEDTNKPQTSESNARRSRISSNITDPWKSVSDEGRIAFQALFSREVLPQSFTYREEHREEEQQQQEQRYPMALDLNFTAQLTPVDDQEEKRNTGFLGIGLDASKLMSRGRTGFKPYKRCSMEAKESRILNNNPIIHVEQKDPKRMRLETQAST

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---METNSSGEDLVI ---CCCCCCCCCEEE	47.33	14978263
6	Phosphorylation	--METNSSGEDLVIK --CCCCCCCCCEEEE	48.55	14593172
562	Phosphorylation	LDASKLMSRGRTGFK CCHHHHHHCCCCCCC	41.86	22074104
566	Phosphorylation	KLMSRGRTGFKPYKR HHHHCCCCCCCCCCC	50.20	22074104

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
5	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
5	S	Phosphorylation	Kinase	CK2	-	Uniprot
6	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
6	S	Phosphorylation	Kinase	CK2	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
5	S	Phosphorylation	14978263
Phosphorylated at Ser-5, Ser-6, and at least at one of the position Ser-431, Ser-432, Ser-433 or Ser-484.
6	S	Phosphorylation	14978263
Phosphorylated at Ser-5, Ser-6, and at least at one of the position Ser-431, Ser-432, Ser-433 or Ser-484.
431	S	Phosphorylation	14978263
Phosphorylated at Ser-5, Ser-6, and at least at one of the position Ser-431, Ser-432, Ser-433 or Ser-484.
432	S	Phosphorylation	14978263
Phosphorylated at Ser-5, Ser-6, and at least at one of the position Ser-431, Ser-432, Ser-433 or Ser-484.
433	S	Phosphorylation	14978263
Phosphorylated at Ser-5, Ser-6, and at least at one of the position Ser-431, Ser-432, Ser-433 or Ser-484.
484	S	Phosphorylation	14978263
Phosphorylated at Ser-5, Ser-6, and at least at one of the position Ser-431, Ser-432, Ser-433 or Ser-484.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CCA1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSK2D_ARATH	CKB3	physical	9724822
CSK2C_ARATH	CKB2	physical	9724822
CSK2B_ARATH	CKB1	physical	9724822
CSK21_ARATH	CKA1	physical	9724822
LHY_ARATH	LHY	genetic	17483414
APRR1_ARATH	TOC1	genetic	17483414
CSK2D_ARATH	CKB3	physical	10535927
LHY_ARATH	LHY	genetic	17540692
APRR1_ARATH	TOC1	genetic	17540692
LHY_ARATH	LHY	genetic	17519251
APRR1_ARATH	TOC1	genetic	17519251
LHY_ARATH	LHY	genetic	17504813
TIC_ARATH	TIC	genetic	17496120
CCA1_ARATH	CCA1	physical	14978263
TCP2_ARATH	TCP2	physical	21183706
TCP11_ARATH	AT2G37000	physical	21183706
DET1_ARATH	DET1	physical	21884973
CCA1_ARATH	CCA1	physical	22715042
LHY_ARATH	LHY	physical	22715042
CCA1_ARATH	CCA1	physical	19218364
LHY_ARATH	LHY	genetic	19218364
LHY_ARATH	LHY	physical	19218364

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CCA1_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"CK2 phosphorylation of CCA1 is necessary for its circadian oscillatorfunction in Arabidopsis."; Daniel X., Sugano S., Tobin E.M.; Proc. Natl. Acad. Sci. U.S.A. 101:3292-3297(2004). Cited for: INTERACTION WITH CKB3, MUTAGENESIS OF SER-5; SER-6; SER-431; SER-432;SER-433 AND SER-484, AND PHOSPHORYLATION AT SER-5 AND SER-6.	14978263 [Abstract]