UniProt ID | CSK2D_ARATH | |
---|---|---|
UniProt AC | O81275 | |
Protein Name | Casein kinase II subunit beta-3 | |
Gene Name | CKB3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 276 | |
Subcellular Localization | Cytoplasm, cytosol . Nucleus . | |
Protein Description | Plays a complex role in regulating the basal catalytic activity of the alpha subunit. The tetrameric holoenzyme CK2, composed of two alpha and two beta subunits, phosphorylates the transcription factor PIF1 after an exposure to light, resulting in a proteasome-dependent degradation of PIF1 and promotion of photomorphogenesis. [PubMed: 21330376 CK2 phosphorylates translation initiation factors. May participate in the regulation of the initiation of translation] | |
Protein Sequence | MYKERSGGGGGGSSRSEILGGAIDRKRINDALNKKLEKSSTSTTTSRVFSSKDKDPFSFTSTKTQLPDVESETDSEGSDVSGSEGDDTSWISWFCNLRGNDFFCEVDEDYIQDDFNLCGLSGQVPYYDYALDLILDVDASNSEMFTDEQHEMVESAAEMLYGLIHVRYILTTKGMAAMTEKYKNCDFGRCPRVFCCGQSCLPVGQSDIPRSSTVKIYCPKCEDISYPRSKFQGNIDGAYFGTTFPHLFLMTYGNLKPQKPTQSYVPKIFGFKVHKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | GGGGSSRSEILGGAI CCCCCCHHHHHCCCC | 30.82 | 30291188 | |
43 | Phosphorylation | LEKSSTSTTTSRVFS HHHCCCCCCCCCCCC | 33.89 | 28011693 | |
44 | Phosphorylation | EKSSTSTTTSRVFSS HHCCCCCCCCCCCCC | 23.65 | 28011693 | |
45 | Phosphorylation | KSSTSTTTSRVFSSK HCCCCCCCCCCCCCC | 18.02 | 28011693 | |
46 | Phosphorylation | SSTSTTTSRVFSSKD CCCCCCCCCCCCCCC | 25.10 | 28011693 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSK2D_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSK2D_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSK2D_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CCA1_ARATH | CCA1 | physical | 14978263 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...