dbPTM

CSK2D_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CSK2D_ARATH
UniProt AC	O81275
Protein Name	Casein kinase II subunit beta-3
Gene Name	CKB3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	276
Subcellular Localization	Cytoplasm, cytosol . Nucleus .
Protein Description	Plays a complex role in regulating the basal catalytic activity of the alpha subunit. The tetrameric holoenzyme CK2, composed of two alpha and two beta subunits, phosphorylates the transcription factor PIF1 after an exposure to light, resulting in a proteasome-dependent degradation of PIF1 and promotion of photomorphogenesis. [PubMed: 21330376 CK2 phosphorylates translation initiation factors. May participate in the regulation of the initiation of translation]
Protein Sequence	MYKERSGGGGGGSSRSEILGGAIDRKRINDALNKKLEKSSTSTTTSRVFSSKDKDPFSFTSTKTQLPDVESETDSEGSDVSGSEGDDTSWISWFCNLRGNDFFCEVDEDYIQDDFNLCGLSGQVPYYDYALDLILDVDASNSEMFTDEQHEMVESAAEMLYGLIHVRYILTTKGMAAMTEKYKNCDFGRCPRVFCCGQSCLPVGQSDIPRSSTVKIYCPKCEDISYPRSKFQGNIDGAYFGTTFPHLFLMTYGNLKPQKPTQSYVPKIFGFKVHKP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	GGGGSSRSEILGGAI CCCCCCHHHHHCCCC	30.82	30291188
43	Phosphorylation	LEKSSTSTTTSRVFS HHHCCCCCCCCCCCC	33.89	28011693
44	Phosphorylation	EKSSTSTTTSRVFSS HHCCCCCCCCCCCCC	23.65	28011693
45	Phosphorylation	KSSTSTTTSRVFSSK HCCCCCCCCCCCCCC	18.02	28011693
46	Phosphorylation	SSTSTTTSRVFSSKD CCCCCCCCCCCCCCC	25.10	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CSK2D_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CSK2D_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CSK2D_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CCA1_ARATH	CCA1	physical	14978263

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CSK2D_ARATH

Related Literatures of Post-Translational Modification