| UniProt ID | CFIS1_ARATH | |
|---|---|---|
| UniProt AC | Q94AF0 | |
| Protein Name | Pre-mRNA cleavage factor Im 25 kDa subunit 1 {ECO:0000303|PubMed:18479511} | |
| Gene Name | CFIS1 {ECO:0000303|PubMed:18479511} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 222 | |
| Subcellular Localization | Nucleus . In punctate subnuclear structures localized adjacent to nuclear speckles, called paraspeckles. | |
| Protein Description | Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export.. | |
| Protein Sequence | MGEEARALDMEEISDNTTRRNDVVHDLMVDLYPLSSYYFGSKEALRVKDEIISDRVIRLKSNYAAHGLRTCVEAVLLVELFKHPHVLLLQYRNSIFKLPGGRLRPGESDIEGLKRKLASKLSVNENVGVSGYEVGECIGMWWRPNFETLMYPFLPPNIKHPKECTKLFLVRLPVHQQFVVPKNFKLLAVPLCQLHENEKTYGPIMSQIPKLLSKFSFNMMEI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CFIS1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CFIS1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CFIS1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HAT14_ARATH | HAT14 | physical | 21798944 | |
| RFS6_ARATH | DIN10 | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...