GRS16_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GRS16_ARATH
• UniProt AC: Q8H7F6
• Protein Name: Bifunctional monothiol glutaredoxin-S16, chloroplastic {ECO:0000303|PubMed:15170506}
• Gene Name: GRXS16 {ECO:0000303|PubMed:15170506}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 293
• Subcellular Localization: Plastid, chloroplast .
• Protein Description: May only reduce GSH-thiol disulfides, but not protein disulfides (Probable). Participates probably to the maturation of iron-sulfur proteins and to the regulation of the redox state of the BOLA proteins (Probable). The GRXS16-BOLA1 heterodimer binds a labile, oxygen sensitive iron-sulfur cluster. [PubMed: 24714563 Able to cleave linearized DNA in vitro]
• Protein Sequence: MAAITISSSLHASASPRVVRPHVSRNTPVITLYSRFTPSFSFPSLSFTLRDTAPSRRRSFFIASAVKSLTETELLPITEADSIPSASGVYAVYDKSDELQFVGISRNIAASVSAHLKSVPELCGSVKVGIVEEPDKAVLTQAWKLWIEEHIKVTGKVPPGNKSGNNTFVKQTPRKKSDIRLTPGRHVELTVPLEELIDRLVKESKVVAFIKGSRSAPQCGFSQRVVGILESQGVDYETVDVLDDEYNHGLRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYENGELANILN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MAAITISSSLHA ---CCCEEECCCCCC	15.30	24924143
7	Phosphorylation	-MAAITISSSLHASA -CCCEEECCCCCCCC	12.77	24924143
15	Phosphorylation	SSLHASASPRVVRPH CCCCCCCCCCEECCC	15.67	24924143
52	Phosphorylation	LSFTLRDTAPSRRRS CEEEEECCCCCHHHH	33.75	23572148

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GRS16_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GRS16_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GRS16_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TOE2_ARATH	TOE2	physical	21798944
IND_ARATH	IND	physical	21798944
SUFE1_ARATH	CPSUFE	physical	24203231
GRS14_ARATH	CXIP1	physical	24203231

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.