GRS14_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GRS14_ARATH
• UniProt AC: Q84Y95
• Protein Name: Monothiol glutaredoxin-S14, chloroplastic {ECO:0000303|PubMed:15170506}
• Gene Name: GRXS14 {ECO:0000303|PubMed:15170506}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 173
• Subcellular Localization: Plastid, chloroplast .
• Protein Description: May only reduce GSH-thiol disulfides, but not protein disulfides (Potential). Probably involved in the regulation of the redox state of the BOLA proteins (Potential). May act as Fe-S cluster donors to Fe-S cluster-requiring proteins. [PubMed: 18044966 May protect cells against protein oxidative damage]
• Protein Sequence: MALRSVKTPTLITSVAVVSSSVTNKPHSIRFSLKPTSALVVHNHQLSFYGSNLKLKPTKFRCSASALTPQLKDTLEKLVNSEKVVLFMKGTRDFPMCGFSNTVVQILKNLNVPFEDVNILENEMLRQGLKEYSNWPTFPQLYIGGEFFGGCDITLEAFKTGELQEEVEKAMCS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
97	Glutathionylation	GTRDFPMCGFSNTVV CCCCCCCCCCCHHHH	5.18	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GRS14_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GRS14_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GRS14_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUFE1_ARATH	CPSUFE	physical	24203231
GRS14_ARATH	CXIP1	physical	24203231

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.