UniProt ID | IAA34_ARATH | |
---|---|---|
UniProt AC | Q9C5X0 | |
Protein Name | Auxin-responsive protein IAA34 | |
Gene Name | IAA34 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 185 | |
Subcellular Localization | Nucleus. | |
Protein Description | Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.. | |
Protein Sequence | MYCSDPPHPLHLVASDKQQKDHKLILSWKKPTMDSDPLGVFPNSPKYHPYYSQTTEFGGVIDLGLSLRTIQHEIYHSSGQRYCSNEGYRRKWGYVKVTMDGLVVGRKVCVLDHGSYSTLAHQLEDMFGMQSVSGLRLFQMESEFCLVYRDEEGLWRNAGDVPWNEFIESVERLRITRRNDAVLPF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of IAA34_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IAA34_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IAA34_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IAA34_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ARFV_ARATH | ARF22 | physical | 21734647 | |
IAA1_ARATH | IAA1 | physical | 21734647 | |
IAA2_ARATH | IAA2 | physical | 21734647 | |
IAA4_ARATH | ATAUX2-11 | physical | 21734647 | |
IAA5_ARATH | IAA5 | physical | 21734647 | |
IAA7_ARATH | IAA7 | physical | 21734647 | |
IAA9_ARATH | IAA9 | physical | 21734647 | |
IAA10_ARATH | IAA10 | physical | 21734647 | |
IAA18_ARATH | IAA18 | physical | 21734647 | |
IAA17_ARATH | AXR3 | physical | 21734647 | |
IAA20_ARATH | IAA20 | physical | 21734647 | |
IAA19_ARATH | IAA19 | physical | 21734647 | |
IAA32_ARATH | IAA32 | physical | 21734647 | |
IAA31_ARATH | IAA31 | physical | 21734647 | |
IAA30_ARATH | IAA30 | physical | 21734647 | |
IAA29_ARATH | IAA29 | physical | 21734647 | |
IAA28_ARATH | IAA28 | physical | 21734647 | |
IAA34_ARATH | IAA34 | physical | 21734647 | |
ARFD_ARATH | ARF4 | physical | 21734647 | |
ARFR_ARATH | ARF18 | physical | 21734647 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...