dbPTM

ARFV_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ARFV_ARATH
UniProt AC	Q9C8N7
Protein Name	Auxin response factor 22
Gene Name	ARF22
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	598
Subcellular Localization	Nucleus.
Protein Description	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression..
Protein Sequence	MESGNIVNAQPELSGIIDGSKSYMYEQLWKLCAGPLCDIPKLGEKIYYFPQGNIELVEASTREELNELKPICDLPSKLQCRVIAIQLKVENNSDETYAEITLMPDTTQVVIPTQNENQFRPLVNSFTKVLTASDTSGGFFVPKKHAIECLPPLDMSQPLPTQELLATDLHGNQWRFNHNYRGTPQRHLLTTGWNAFTTSKKLVAGDVIVFVRGETGELRVGIRRAGHQQGNIPSSIISIESMRHGVIASAKHAFDNQCMFIVVYKPRSSQFIVSYDKFLDAVNNKFNVGSRFTMRFEGDDFSERRYFGTIIGVSDFSPHWKCSEWRNLEVQWDEFASFSRPNKVSPWEIEHLMPALNVPRPSLLKNKRLREVNEIGSSSSHLLPPILTQGQEIGQLSVASPMNISLTYRDTTEDVMNPSRLLMSYPVQPMPKLNYNNQMVTQIEENITTKTGTNFRLFGVSLVTPSVIKDPIEEIGSEISKLTEGKKFGQSQTLRSPTEIQSKQFSSTRTCTKVQMQGVTIERAVDLSVLNGYDQLILELEELFDLKGQLQTRNQWEIAFTDSDDDKMLVGDDPWPEFCNMVKKILIFKRGGQKLEVQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ARFV_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ARFV_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ARFV_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ARFV_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IAA28_ARATH	IAA28	physical	21734647
IAA20_ARATH	IAA20	physical	21734647
IAA16_ARATH	IAA16	physical	21734647
IAA7_ARATH	IAA7	physical	21734647
ARFL_ARATH	ARF12	physical	21734647
IAA32_ARATH	IAA32	physical	25566309
IAA34_ARATH	IAA34	physical	25566309

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ARFV_ARATH

Related Literatures of Post-Translational Modification