dbPTM

IAA32_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IAA32_ARATH
UniProt AC	Q8RYC6
Protein Name	Auxin-responsive protein IAA32 {ECO:0000303\|PubMed:12036262}
Gene Name	IAA32 {ECO:0000303\|PubMed:12036262}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	191
Subcellular Localization	Nucleus.
Protein Description	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression..
Protein Sequence	MDPNTPADFFKGSSKFHTYYSQTKKGGGVIDLGLSLRTIQHETYLPPARMIGLDGYGELIDWSQPSYNSITQLKSEDTGHQRLAQGYYNNEGESRGKYAYVKVNLDGLVVGRKVCLVDQGAYATLALQLNDMFGMQTVSGLRLFQTESEFSLVYRDREGIWRNVGDVPWKEFVESVDRMRIARRNDALLPF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of IAA32_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IAA32_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IAA32_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IAA32_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARFS_ARATH	ARF19	physical	21734647
ARFV_ARATH	ARF22	physical	21734647
IAA5_ARATH	IAA5	physical	21734647
IAA16_ARATH	IAA16	physical	21734647
IAA20_ARATH	IAA20	physical	21734647
ARFF_ARATH	ARF6	physical	21734647
ARFG_ARATH	NPH4	physical	21734647
ARFJ_ARATH	ARF10	physical	21734647
ARFR_ARATH	ARF18	physical	21734647
ARFQ_ARATH	ARF17	physical	21734647
ARFP_ARATH	ARF16	physical	21734647

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IAA32_ARATH

Related Literatures of Post-Translational Modification