GRS15_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GRS15_ARATH
• UniProt AC: Q8LBK6
• Protein Name: Monothiol glutaredoxin-S15, mitochondrial {ECO:0000303|PubMed:15170506}
• Gene Name: GRXS15 {ECO:0000303|PubMed:15170506}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 169
• Subcellular Localization: Mitochondrion .
• Protein Description: May only reduce GSH-thiol disulfides, but not protein disulfides. Participates probably to the maturation of iron-sulfur proteins and to the regulation of the redox state of the BOLA proteins..
• Protein Sequence: MAASLSSRLIKGIANLKAVRSSRLTSASVYQNGMMRFSSTVPSDSDTHDDFKPTQKVPPDSTDSLKDIVENDVKDNPVMIYMKGVPESPQCGFSSLAVRVLQQYNVPISSRNILEDQELKNAVKSFSHWPTFPQIFIKGEFIGGSDIILNMHKEGELEQKLKDVSGNQD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
79	Sulfoxidation	DVKDNPVMIYMKGVP CCCCCCEEEEECCCC	1.59	25693801
82	Sulfoxidation	DNPVMIYMKGVPESP CCCEEEEECCCCCCC	1.79	25693801
151	Sulfoxidation	GSDIILNMHKEGELE CCCEEEECCCCCHHH	4.24	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GRS15_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GRS15_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GRS15_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AK1_ARATH	AK-LYS1	physical	21798944
GLYP3_ARATH	SHM3	physical	21798944
PANB2_ARATH	PANB2	physical	21798944
SUFE1_ARATH	CPSUFE	physical	24203231

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.