dbPTM

IAA6_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IAA6_ARATH
UniProt AC	Q38824
Protein Name	Auxin-responsive protein IAA6
Gene Name	IAA6
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	189
Subcellular Localization	Nucleus.
Protein Description	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression..
Protein Sequence	MAKEGLALEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVEDESLPVVKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLVTVLENLFGCLGIGVAKEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFGLQQD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
90	Phosphorylation	KKNNEEASKAIGYVK CCCCHHHHHHHCEEE	26.37	19880383
95	Phosphorylation	EASKAIGYVKVSMDG HHHHHHCEEEEECCC	7.32	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IAA6_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IAA6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IAA6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IAA1_ARATH	IAA1	physical	21798944
IAA28_ARATH	IAA28	physical	21798944
ARFE_ARATH	MP	physical	22096563
IAA34_ARATH	IAA34	physical	21734647
IAA17_ARATH	AXR3	physical	21734647
IAA6_ARATH	IAA6	physical	14729917

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IAA6_ARATH

Related Literatures of Post-Translational Modification