IAA33_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IAA33_ARATH
• UniProt AC: Q9FKM7
• Protein Name: Auxin-responsive protein IAA33
• Gene Name: IAA33
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 171
• Subcellular Localization: Nucleus.
• Protein Description: Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression..
• Protein Sequence: MNSFEPQSQDSLQRRFHQDNSTTQQPRDTTTPFIPKPASKNHNNSNSSSGAAGRSFQGFGLNVEDDLVSSVVPPVTVVLEGRSICQRISLDKHGSYQSLASALRQMFVDGADSTDDLDLSNAIPGHLIAYEDMENDLLLAGDLTWKDFVRVAKRIRILPVKGNTRQVKRNE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of IAA33_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IAA33_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IAA33_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IAA33_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARFT_ARATH	ARF20	physical	21734647
IAA27_ARATH	PAP2	physical	21734647
IAA30_ARATH	IAA30	physical	21734647
IAA34_ARATH	IAA34	physical	21734647
ARFE_ARATH	MP	physical	21734647
ARFJ_ARATH	ARF10	physical	21734647
ARFP_ARATH	ARF16	physical	21734647

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.