IAA15_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IAA15_ARATH
• UniProt AC: Q9C966
• Protein Name: Auxin-responsive protein IAA15
• Gene Name: IAA15
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 179
• Subcellular Localization: Nucleus.
• Protein Description: Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression..
• Protein Sequence: MSPEEYVRVWPDSGDLGGTELTLALPGTPTNASEGPKKFGNKRRFLETVDLKLGEAHENNYISSMVTNDQLVGWPPVATARKTVRRKYVKVALDGAAYLRKVDLGMYDCYGQLFTALENMFQGIITICRVTELERKGEFVATYEDKDGDLMLVGDVPWMMFVESCKRMRLMKTGDAIGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSPEEYVRV ------CCHHHHEEE	40.81	23776212
6	Phosphorylation	--MSPEEYVRVWPDS --CCHHHHEEECCCC	7.59	23776212
13	Phosphorylation	YVRVWPDSGDLGGTE HEEECCCCCCCCCCE	30.08	23776212
19	Phosphorylation	DSGDLGGTELTLALP CCCCCCCCEEEEECC	26.48	23776212
22	Phosphorylation	DLGGTELTLALPGTP CCCCCEEEEECCCCC	12.07	23776212
28	Phosphorylation	LTLALPGTPTNASEG EEEECCCCCCCCCCC	25.63	23776212
30	Phosphorylation	LALPGTPTNASEGPK EECCCCCCCCCCCCC	43.16	23776212
33	Phosphorylation	PGTPTNASEGPKKFG CCCCCCCCCCCCCCC	45.19	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IAA15_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IAA15_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IAA15_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARFS_ARATH	ARF19	physical	21734647
ARFT_ARATH	ARF20	physical	21734647
IAA1_ARATH	IAA1	physical	21734647
IAA3_ARATH	SHY2	physical	21734647
IAA4_ARATH	ATAUX2-11	physical	21734647
IAA5_ARATH	IAA5	physical	21734647
IAA9_ARATH	IAA9	physical	21734647
IAA10_ARATH	IAA10	physical	21734647
IAA13_ARATH	IAA13	physical	21734647
IAA12_ARATH	IAA12	physical	21734647
IAA19_ARATH	IAA19	physical	21734647
IAA18_ARATH	IAA18	physical	21734647
IAA15_ARATH	IAA15	physical	21734647
IAA34_ARATH	IAA34	physical	21734647
IAA33_ARATH	IAA33	physical	21734647
IAA32_ARATH	IAA32	physical	21734647
ARFE_ARATH	MP	physical	21734647
ARFG_ARATH	NPH4	physical	21734647

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.