| UniProt ID | RIC4_ARATH | |
|---|---|---|
| UniProt AC | Q9FFD5 | |
| Protein Name | CRIB domain-containing protein RIC4 | |
| Gene Name | RIC4 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 153 | |
| Subcellular Localization |
Cell membrane Peripheral membrane protein . |
|
| Protein Description | Functions as downstream effector of Rho-related GTP binding proteins of the "Rho of Plants" (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Required for actin cortical microfilament assembly. Activated by ARAC4/ROP2 to promote the assembly of cortical actin microfilaments required for lobe formation and lateral expansion of pavement cells. Interaction with, and activation by ARAC4/ROP2 is inhibited by RIC1. Functions as downstream effector of ARAC11/ROP1 to promote the assembly of apical F-actin associated with vesicle accumulation in the tip of the growing pollen tube. Counteracts the ARAC11/ROP1-RIC3 pathway, which activates calcium signaling that leads to apical F-actin disassembly associated with exocytosis, to control actin dynamics and pollen tube apical growth. Downstream of ARAC11/ROP1, is involved in the growth responses to the root-colonizing endophytic fungus P.indica.. | |
| Protein Sequence | MRDRMERLVVLPFSIGCISVSSVAVLSPLSKPHHHHSRQVIREQEEEDNMKNVFKFLAVSKPEISIGINRIFKSFKTISQLFADKDEEKEEVETSGMEIGVPTNVKHVSHIGWESGLTAATGPGKGWEDLIPPELLAAAASKKEINPHLHPTL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of RIC4_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIC4_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIC4_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIC4_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RIC4_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...