dbPTM

RIC4_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RIC4_ARATH
UniProt AC	Q9FFD5
Protein Name	CRIB domain-containing protein RIC4
Gene Name	RIC4
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	153
Subcellular Localization	Cell membrane Peripheral membrane protein .
Protein Description	Functions as downstream effector of Rho-related GTP binding proteins of the "Rho of Plants" (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Required for actin cortical microfilament assembly. Activated by ARAC4/ROP2 to promote the assembly of cortical actin microfilaments required for lobe formation and lateral expansion of pavement cells. Interaction with, and activation by ARAC4/ROP2 is inhibited by RIC1. Functions as downstream effector of ARAC11/ROP1 to promote the assembly of apical F-actin associated with vesicle accumulation in the tip of the growing pollen tube. Counteracts the ARAC11/ROP1-RIC3 pathway, which activates calcium signaling that leads to apical F-actin disassembly associated with exocytosis, to control actin dynamics and pollen tube apical growth. Downstream of ARAC11/ROP1, is involved in the growth responses to the root-colonizing endophytic fungus P.indica..
Protein Sequence	MRDRMERLVVLPFSIGCISVSSVAVLSPLSKPHHHHSRQVIREQEEEDNMKNVFKFLAVSKPEISIGINRIFKSFKTISQLFADKDEEKEEVETSGMEIGVPTNVKHVSHIGWESGLTAATGPGKGWEDLIPPELLAAAASKKEINPHLHPTL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RIC4_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RIC4_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RIC4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RIC4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RIC4_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RIC4_ARATH

Related Literatures of Post-Translational Modification