SAP18_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SAP18_ARATH
• UniProt AC: O64644
• Protein Name: Histone deacetylase complex subunit SAP18
• Gene Name: At2g45640
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 152
• Protein Description: Links the histone deacetylase complex to transcriptional repressors bound to chromatin. Involved in the tethering of the SIN3 complex to core histone proteins..
• Protein Sequence: MAEAARRQGGGRPLPPPPRGVNQQPPRPKPEPVDREKTCPLLLRVFTKSGGHHTSEDYAVRGKEPKDEVQIYTWKDASLRELTDLVKEVSVAARRRNARLSFAFVYPNNKGGYNVREVGETMAYPNRKQPDDSKTLSELPFEIGDYLDVAIY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
122	Sulfoxidation	VREVGETMAYPNRKQ EECCCCEECCCCCCC	2.68	23289948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SAP18_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SAP18_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SAP18_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HDA19_ARATH	HD1	physical	16429262
ERF82_ARATH	ERF3	physical	16429262
ERF78_ARATH	ERF4	physical	16429262
SAP18_ARATH	SAP18	physical	17999645
AGL15_ARATH	AGL15	physical	17999645
HDA6_ARATH	HDA6	physical	17999645
SOC1_ARATH	AGL20	physical	19460347
AGL24_ARATH	AGL24	physical	19460347

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.