HDA6_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HDA6_ARATH
• UniProt AC: Q9FML2
• Protein Name: Histone deacetylase 6
• Gene Name: HDA6
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 471
• Subcellular Localization: Nucleus, nucleolus . Nucleus .
• Protein Description: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Might remove acetyl residues only from specific targets, such as rDNA repeats or complex transgenes. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Required for rRNA gene silencing in nucleolar dominance. Plays a role in transgene silencing, but this effect seems to bee independent of the histone deacetylase activity. [PubMed: 11340181]
• Protein Sequence: MEADESGISLPSGPDGRKRRVSYFYEPTIGDYYYGQGHPMKPHRIRMAHSLIIHYHLHRRLEISRPSLADASDIGRFHSPEYVDFLASVSPESMGDPSAARNLRRFNVGEDCPVFDGLFDFCRASAGGSIGAAVKLNRQDADIAINWGGGLHHAKKSEASGFCYVNDIVLGILELLKMFKRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIRDVGAEKGKYYALNVPLNDGMDDESFRSLFRPLIQKVMEVYQPEAVVLQCGADSLSGDRLGCFNLSVKGHADCLRFLRSYNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNEYFEYFGPDYTLHVDPSPMENLNTPKDMERIRNTLLEQLSGLIHAPSVQFQHTPPVNRVLDEPEDDMETRPKPRIWSGTATYESDSDDDDKPLHGYSCRGGATTDRDSTGEDEMDDDNPEPDVNPPSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEADESGI -------CCCCCCCC	9.63	22223895
420	Phosphorylation	RPKPRIWSGTATYES CCCCCEEEEEEEEEC	24.72	23776212
422	Phosphorylation	KPRIWSGTATYESDS CCCEEEEEEEEECCC	15.43	23776212
424	Phosphorylation	RIWSGTATYESDSDD CEEEEEEEEECCCCC	27.88	23776212
425	Phosphorylation	IWSGTATYESDSDDD EEEEEEEEECCCCCC	15.80	23776212
427	Phosphorylation	SGTATYESDSDDDDK EEEEEEECCCCCCCC	31.81	23776212
429	Phosphorylation	TATYESDSDDDDKPL EEEEECCCCCCCCCC	52.82	23776212
440	Phosphorylation	DKPLHGYSCRGGATT CCCCCCEECCCCCCC	11.26	23776212
446	Phosphorylation	YSCRGGATTDRDSTG EECCCCCCCCCCCCC	32.29	23776212
447	Phosphorylation	SCRGGATTDRDSTGE ECCCCCCCCCCCCCC	28.62	23776212
451	Phosphorylation	GATTDRDSTGEDEMD CCCCCCCCCCCCCCC	38.92	23776212
452	Phosphorylation	ATTDRDSTGEDEMDD CCCCCCCCCCCCCCC	49.21	23776212
470	Phosphorylation	EPDVNPPSS------ CCCCCCCCC------	50.35	23776212
471	Phosphorylation	PDVNPPSS------- CCCCCCCC-------	50.44	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HDA6_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HDA6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HDA6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
H2A3_ARATH	HTA2	physical	16648464
H2B10_ARATH	HTB2	physical	16648464
H33_ARATH	AT4G40030	physical	16648464
SAP18_ARATH	SAP18	physical	17999645
FLD_ARATH	FLD	physical	21398257
EIN3_ARATH	EIN3	physical	21737749
EIL1_ARATH	EIL1	physical	21737749
DNMT1_ARATH	MET1	physical	21994348
MSI5_ARATH	NFC5	physical	22102827
MSI4_ARATH	FVE	physical	22102827
HDT3_ARATH	HD2C	physical	22368268
AS1_ARATH	AS1	physical	23271976
TPL_ARATH	TPL	physical	23267111

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.