dbPTM

HDT3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HDT3_ARATH
UniProt AC	Q9LZR5
Protein Name	Histone deacetylase HDT3
Gene Name	HDT3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	294
Subcellular Localization	Nucleus, nucleolus .
Protein Description	Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Involved in the modulation of abscisic acid and stress-responsive genes..
Protein Sequence	MEFWGVEVKNGKPLHLDPGLDRLVHISQVALGESKNNVTEPIQLYVTVGSDKLLIGTLSHEKFPQLSTEIVLERNFALSHTWKNGSVFFSGYKVDASDPEPEDLIDDQLEAAGFKAAPKSAAKQVNFQLPNEDVKAKQDDDADGSEEDSSDDDDSENSGDEEEEKVTAESDSEEDDSSDDEEDDSSEEETPKKPEEPKKRSAEPNSSKNPASNKKAKFVTPQKTDSKKPHVHVATPHPSKQAGKNSGGGSTGETSKQQQTPKSAGAFGCKSCTRTFTSEMGLQSHTKAKHSAAA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEFWGVEV -------CCCCCEEE	9.64	22223895
284	Phosphorylation	TSEMGLQSHTKAKHS CHHHCCHHHHHHCHH	37.86	25561503
286	Phosphorylation	EMGLQSHTKAKHSAA HHCCHHHHHHCHHCC	37.63	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HDT3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HDT3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HDT3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
HDA6_ARATH	HDA6	physical	22368268

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HDT3_ARATH

Related Literatures of Post-Translational Modification