ERF78_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ERF78_ARATH
• UniProt AC: O80340
• Protein Name: Ethylene-responsive transcription factor 4
• Gene Name: ERF4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 222
• Subcellular Localization: Nucleus .
• Protein Description: Acts as a transcriptional repressor. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways, and could also regulate other AtERFs..
• Protein Sequence: MAKMGLKPDPATTNQTHNNAKEIRYRGVRKRPWGRYAAEIRDPGKKTRVWLGTFDTAEEAARAYDTAARDFRGAKAKTNFPTFLELSDQKVPTGFARSPSQSSTLDCASPPTLVVPSATAGNVPPQLELSLGGGGGGSCYQIPMSRPVYFLDLMGIGNVGRGQPPPVTSAFRSPVVHVATKMACGAQSDSDSSSVVDFEGGMEKRSQLLDLDLNLPPPSEQA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ERF78_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ERF78_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ERF78_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ERF78_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDKE1_ARATH	CDKE;1	physical	25281690
MED25_ARATH	PFT1	physical	25281690

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.