CSN2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CSN2_ARATH
• UniProt AC: Q8W207
• Protein Name: COP9 signalosome complex subunit 2
• Gene Name: CSN2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 439
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex..
• Protein Sequence: MASDADMEDYGFEYSDEEQEEQDVDIENQYYNSKGMVETEPEEALSGFAEVVQMEPEKADWGFKALKQTVKIYYRLGKYKEMMEAYTEMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNTGLLQEFYQTTLKALEEAKNERLWFKTNLKLCNIWFDIGEYRRMTKILKELHKSCQKEDGTDDQKKGSQLLEVYAIEIQIYTETKDNKKLKQLYHKALAIKSAIPHPRIMGIIRECGGKMHMAERQWEEAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFERILKSNRRTIMDDPFIRNYMEDLLKKVRTQVLLKLIKPYTKIGIPFISKELNVPETDVTELLVSLILDSRIDGHIDEMNRYLLRGDSGNGRKLHKAVDKWNSQLKSLSSNITSRVC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	EDYGFEYSDEEQEEQ HHHCCCCCCHHHHHC	31.20	27531888
86	Phosphorylation	YKEMMEAYTEMLTYI HHHHHHHHHHHHHHH	7.02	19880383
87	Phosphorylation	KEMMEAYTEMLTYIK HHHHHHHHHHHHHHH	23.20	19880383
91	Phosphorylation	EAYTEMLTYIKSAVT HHHHHHHHHHHHHHH	23.14	19880383
92	Phosphorylation	AYTEMLTYIKSAVTR HHHHHHHHHHHHHHC	11.46	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CSN2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CSN2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CSN2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSN4_ARATH	COP8	physical	12615944
CSN5A_ARATH	CSN5A	physical	12615944
CSN1_ARATH	FUS6	physical	12615944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.