VA714_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VA714_ARATH
• UniProt AC: Q9FMR5
• Protein Name: Vesicle-associated membrane protein 714 {ECO:0000303|PubMed:11115874}
• Gene Name: VAMP714 {ECO:0000303|PubMed:11115874}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 221
• Subcellular Localization: Golgi apparatus membrane ; Single-pass type IV membrane protein .
• Protein Description: Involved in the targeting and/or fusion of transport vesicles to their target membrane..
• Protein Sequence: MAIVYAVVARGTVVLAEFSAVTGNTGAVVRRILEKLSPEISDERLCFSQDRYIFHILRSDGLTFLCMANDTFGRRVPFSYLEEIHMRFMKNYGKVAHNAPAYAMNDEFSRVLHQQMEFFSSNPSVDTLNRVRGEVSEIRSVMVENIEKIMERGDRIELLVDKTATMQDSSFHFRKQSKRLRRALWMKNAKLLVLLTCLIVFLLYIIIASFCGGITLPSCRS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAIVYAVVA ------CCEEEEEEE	10.43	22223895
163	Phosphorylation	IELLVDKTATMQDSS EEEEEECCCCCCCCC	23.93	25561503
165	Phosphorylation	LLVDKTATMQDSSFH EEEECCCCCCCCCHH	22.16	25561503
169	Phosphorylation	KTATMQDSSFHFRKQ CCCCCCCCCHHHHHH	20.29	30407730
170	Phosphorylation	TATMQDSSFHFRKQS CCCCCCCCHHHHHHH	30.91	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VA714_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VA714_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VA714_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of VA714_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.