RBS3B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RBS3B_ARATH
• UniProt AC: P10798
• Protein Name: Ribulose bisphosphate carboxylase small chain 3B, chloroplastic
• Gene Name: RBCS-3B
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 181
• Subcellular Localization: Plastid, chloroplast.
• Protein Description: RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity)..
• Protein Sequence: MASSMLSSAAVVTSPAQATMVAPFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	ATMVAPFTGLKSSAA CEEEECCCCCCCCCC	40.31	24243849
39	Phosphorylation	AFPVTRKTNKDITSI CEECCCCCCCCHHHH	44.18	24894044
44	Phosphorylation	RKTNKDITSIASNGG CCCCCCHHHHHCCCC	24.98	24894044
48	Phosphorylation	KDITSIASNGGRVSC CCHHHHHCCCCCEEE	34.05	23111157
69	Phosphorylation	IGKKKFETLSYLPDL CCCCCEEEECCCCCC	24.92	22092075
71	Phosphorylation	KKKFETLSYLPDLSD CCCEEEECCCCCCCH	31.85	25368622
72	Phosphorylation	KKFETLSYLPDLSDV CCEEEECCCCCCCHH	25.93	25368622
77	Phosphorylation	LSYLPDLSDVELAKE ECCCCCCCHHHHHHH	47.17	30291188
87	Phosphorylation	ELAKEVDYLLRNKWI HHHHHHHHHHHCCCC	16.89	29654922
92	Acetylation	VDYLLRNKWIPCVEF HHHHHHCCCCCEEEE	39.81	-
113	Phosphorylation	VYREHGNTPGYYDGR EEEEECCCCCCCCCC	23.76	29654922
133	Phosphorylation	KLPLFGCTDSAQVLK EEEECCCCCHHHHHH	33.11	30291188
135	Phosphorylation	PLFGCTDSAQVLKEV EECCCCCHHHHHHHH	11.49	30291188
149	Phosphorylation	VEECKKEYPGAFIRI HHHHHHHCCCCEEEE	18.82	19880383
162	Phosphorylation	RIIGFDNTRQVQCIS EEEEECCCCEEEEEE	25.07	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RBS3B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RBS3B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RBS3B_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RBS3B_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.