UniProt ID | SPR1_ARATH | |
---|---|---|
UniProt AC | Q9SJW3 | |
Protein Name | Protein SPIRAL1 | |
Gene Name | SPR1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 119 | |
Subcellular Localization | Cytoplasm, cytoskeleton, phragmoplast . Cytoplasm, cytoskeleton, spindle . | |
Protein Description | Required for directional control of cell elongation. Stabilizes growing ends of cortical microtubules and influences their dynamic properties. Acts redundantly with SP1Ls in maintaining the cortical microtubules organization essential for anisotropic cell growth. Plays a key role in salt stress-induced microtubules disassembly.. | |
Protein Sequence | MGRGNSCGGGQSSLDYLFGGDAPAPKPVPAPRPAPTESNNGPAPPVTAVTATALTTATTSVEPAELNKQIPAGIKTPVNNYARAEGQNTGNFLTDRPSTKVHAAPGGGSSLDYLFTGGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
76 | Phosphorylation | QIPAGIKTPVNNYAR CCCCCCCCCCCCCHH | 30.46 | 29654922 | |
109 | Phosphorylation | HAAPGGGSSLDYLFT EECCCCCCCCCEEEC | 30.88 | 24894044 | |
110 | Phosphorylation | AAPGGGSSLDYLFTG ECCCCCCCCCEEECC | 28.65 | 24894044 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPR1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPR1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPR1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EB1B_ARATH | EB1B | physical | 25415978 | |
TBA2_ARATH | TUA4 | physical | 25415978 | |
TBA4_ARATH | TUA4 | physical | 25415978 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...