SPR1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPR1_ARATH
• UniProt AC: Q9SJW3
• Protein Name: Protein SPIRAL1
• Gene Name: SPR1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 119
• Subcellular Localization: Cytoplasm, cytoskeleton, phragmoplast . Cytoplasm, cytoskeleton, spindle .
• Protein Description: Required for directional control of cell elongation. Stabilizes growing ends of cortical microtubules and influences their dynamic properties. Acts redundantly with SP1Ls in maintaining the cortical microtubules organization essential for anisotropic cell growth. Plays a key role in salt stress-induced microtubules disassembly..
• Protein Sequence: MGRGNSCGGGQSSLDYLFGGDAPAPKPVPAPRPAPTESNNGPAPPVTAVTATALTTATTSVEPAELNKQIPAGIKTPVNNYARAEGQNTGNFLTDRPSTKVHAAPGGGSSLDYLFTGGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
76	Phosphorylation	QIPAGIKTPVNNYAR CCCCCCCCCCCCCHH	30.46	29654922
109	Phosphorylation	HAAPGGGSSLDYLFT EECCCCCCCCCEEEC	30.88	24894044
110	Phosphorylation	AAPGGGSSLDYLFTG ECCCCCCCCCEEECC	28.65	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPR1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPR1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPR1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EB1B_ARATH	EB1B	physical	25415978
TBA2_ARATH	TUA4	physical	25415978
TBA4_ARATH	TUA4	physical	25415978

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.