NDA8B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NDA8B_ARATH
• UniProt AC: Q8LGE7
• Protein Name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B
• Gene Name: At5g18800
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 106
• Subcellular Localization: Mitochondrion. Mitochondrion intermembrane space.
• Protein Description: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)..
• Protein Sequence: MSSAVDATGNPIPTSAVLTASAKHIGMRCMPENVAFLKCKKNDPNPEKCLDKGRDVTRCVLGLLKDLHQKCQKEMDDYVGCMYYYTNEFDLCRKEQEAFEKVCPLK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSSAVDATG ------CCCCCCCCC	27.31	22223895
2	Phosphorylation	------MSSAVDATG ------CCCCCCCCC	27.31	19376835
3	Phosphorylation	-----MSSAVDATGN -----CCCCCCCCCC	30.89	19376835
8	Phosphorylation	MSSAVDATGNPIPTS CCCCCCCCCCCCCCH	32.78	19376835
14	Phosphorylation	ATGNPIPTSAVLTAS CCCCCCCCHHHHHHH	30.00	19376835
15	Phosphorylation	TGNPIPTSAVLTASA CCCCCCCHHHHHHHH	15.83	19376835
19	Phosphorylation	IPTSAVLTASAKHIG CCCHHHHHHHHHHHC	16.39	19376835
21	Phosphorylation	TSAVLTASAKHIGMR CHHHHHHHHHHHCCC	32.39	19376835

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NDA8B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NDA8B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NDA8B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.