ULT1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ULT1_ARATH
• UniProt AC: Q8GZA8
• Protein Name: Protein ULTRAPETALA 1
• Gene Name: ULT1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 237
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Putative transcription factor that acts as a key negative regulator of cell accumulation in shoot and floral meristems. Negatively regulates the size of the WUSCHEL (WUS)-expressing organizing center in inflorescence meristems. May act by down-regulating expression of WUS..
• Protein Sequence: MANNEGEMQCGSMLFKQEELQEMSGVNVGGDYVEVMCGCTSHRYGDAVARLRVFPTGDLEITCECTPGCDEDKLTPAAFEKHSGRETARKWKNNVWVIIGGEKVPLSKTVLLKYYNESSKKCSRSNRSQGAKVCHRDEFVGCNDCGKERRFRLRSRDECRLHHNAMGDPNWKCSDFPYDKITCEEEEERGSRKVYRGCTRSPSCKGCTSCVCFGCELCRFSECTCQTCVDFTSNVKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ULT1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ULT1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ULT1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ULT1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ATX1_ARATH	ATX1	physical	19952107
ULT2_ARATH	ULT2	physical	23446032
KAN1_ARATH	KAN	physical	25381352
KAN2_ARATH	KAN2	physical	25381352
ULT2_ARATH	ULT2	physical	25381352

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.