dbPTM

GAT24_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GAT24_ARATH
UniProt AC	Q8GXL7
Protein Name	GATA transcription factor 24
Gene Name	GATA24
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	297
Subcellular Localization	Nucleus .
Protein Description	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters..
Protein Sequence	MDDLHGRNGRMHIGVAQNPMHVQYEDHGLHHIDNENSMMDDHADGGMDEGVETDIPSHPGNSADNRGEVVDRGIENGDQLTLSFQGQVYVFDRVSPEKVQAVLLLLGGREVPHTLPTTLGSPHQNNRVLGLSGTPQRLSVPQRLASLLRFREKRKGRNFDKTIRYTVRKEVALRMQRKKGQFTSAKSSNDDSGSTGSDWGSNQSWAVEGTETQKPEVLCRHCGTSEKSTPMMRRGPDGPRTLCNACGLMWANKGTLRDLSKVPPPQTPQHLSLNKNEDANLEADQMMEVTGDISNTQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
114	Phosphorylation	GGREVPHTLPTTLGS CCCCCCCCCCCCCCC	28.50	25561503
117	Phosphorylation	EVPHTLPTTLGSPHQ CCCCCCCCCCCCCCC	37.45	25561503
118	Phosphorylation	VPHTLPTTLGSPHQN CCCCCCCCCCCCCCC	27.47	25561503
121	Phosphorylation	TLPTTLGSPHQNNRV CCCCCCCCCCCCCCE	23.48	30291188
121 (in isoform 2)	Phosphorylation	-	23.48	29654922
267	Phosphorylation	SKVPPPQTPQHLSLN HCCCCCCCCCCCCCC	30.59	25561503
294	Phosphorylation	MEVTGDISNTQ---- HHHHCCCCCCC----	38.27	25561503
296	Phosphorylation	VTGDISNTQ------ HHCCCCCCC------	28.94	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GAT24_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GAT24_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GAT24_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
EM506_ARATH	EMB506	physical	21798944
GAT24_ARATH	ZML1	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GAT24_ARATH

Related Literatures of Post-Translational Modification