dbPTM

TIM8_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TIM8_ARATH
UniProt AC	Q9XGY4
Protein Name	Mitochondrial import inner membrane translocase subunit TIM8
Gene Name	TIM8
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	77
Subcellular Localization	Mitochondrion intermembrane space .
Protein Description	Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex mediates the import of some proteins while the predominant TIM9-TIM10 70 kDa complex mediates the import of much more proteins (By similarity)..
Protein Sequence	MDPSMANNPELLQFLAQEKERAMVNEMVSKMTSVCWDKCITSAPGSKFSSSESSCLTHCAQRYMDMSMIIMKRFNSQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDPSMANN -------CCHHHHCC	18.04	22223895
23	Sulfoxidation	AQEKERAMVNEMVSK HHHHHHHHHHHHHHH	4.10	23289948
27	Sulfoxidation	ERAMVNEMVSKMTSV HHHHHHHHHHHHHHH	3.30	23289948
63	Phosphorylation	LTHCAQRYMDMSMII HHHHHHHHHHHHHHH	5.84	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TIM8_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TIM8_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TIM8_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TIM8_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TIM8_ARATH

Related Literatures of Post-Translational Modification