dbPTM

PER26_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PER26_ARATH
UniProt AC	O22862
Protein Name	Probable peroxidase 26
Gene Name	PER26
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	335
Subcellular Localization	Secreted .
Protein Description	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress (Probable). The enzyme activity has to be proved..
Protein Sequence	MVMIHIFLTVMVVGGVSLFPETAEAIVMGPSMQKLTWHYYKVYNTCENAENFVRHQVEIFYKNDKSIAPKLLRLLYSDCFVSGCDASVLLEGPNSEKMAPQNRGLGGFVLIDKIKIVLEQRCPGVVSCADILNLATRDAVHLAGAPSYPVFTGRRDGLTSDKQTVDLPSPSISWDQAMSYFKSRGLNVLDMATLLGSHSMGRTHCSYVVDRLYNYNKTGKPSPTMNKYFLSEMAKQCPPRTRKGQTDPLVYLNPDSGSNHSFTSSFYSRILSNKSVLEVDQQLLYNDDTKQISKEFSEGFEDFRKSFALSMSKMGAINVLTKTEGEIRKDCRHIN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
193	Phosphorylation	LNVLDMATLLGSHSM CCHHHHHHHHCCCCC	18.84	24894044
216	N-linked_Glycosylation	VDRLYNYNKTGKPSP HHHHHCCCCCCCCCC	31.60	-
259	N-linked_Glycosylation	LNPDSGSNHSFTSSF ECCCCCCCCCCCHHH	38.04	-
273	N-linked_Glycosylation	FYSRILSNKSVLEVD HHHHHHCCCCEEEHH	36.86	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PER26_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PER26_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PER26_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PER26_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PER26_ARATH

Related Literatures of Post-Translational Modification