dbPTM

LPP1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LPP1_ARATH
UniProt AC	Q9ZU49
Protein Name	Lipid phosphate phosphatase 1
Gene Name	LPP1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	327
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description	Plays a general role in cellular responses to stress, may be by attenuating the signal produced by phospholipases. Exhibits both diacylglycerol pyrophosphate (DGPP) phosphatase and phosphatidate (PA) phosphatase activities. Substrate preference is diacylglycerol pyrophosphate > phosphatidate..
Protein Sequence	MTIGSFFSSLLFWRNSQDQEAQRGRMQEIDLSVHTIKSHGGRVASKHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVLLPIIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPDGKELYDALGGVVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGHVAKLCLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEEGWGPYAYFKAAQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
295	Phosphorylation	QERGVPVTSSQNGDA HHHCCCCCCCCCHHH	19.32	30407730
296	Phosphorylation	ERGVPVTSSQNGDAL HHCCCCCCCCCHHHH	30.11	30407730
297	Phosphorylation	RGVPVTSSQNGDALR HCCCCCCCCCHHHHH	20.49	17317660
307	Phosphorylation	GDALRAMSLQMDSTS HHHHHHHEEECCCCC	17.92	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LPP1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LPP1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LPP1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of LPP1_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LPP1_ARATH

Related Literatures of Post-Translational Modification