dbPTM

RECA3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RECA3_ARATH
UniProt AC	Q9ZUP2
Protein Name	DNA repair protein recA homolog 3, mitochondrial
Gene Name	At2g19490
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	430
Subcellular Localization	Mitochondrion .
Protein Description	Involved in recombination ability and DNA strand transfer activity..
Protein Sequence	MARILRNVYSLRSSLFSSELLRRSVVGTSFQLRGFAAKAKKKSKSDGNGSSEEGMSKKEIALQQALDQITSSFGKGSIMYLGRAVSPRNVPVFSTGSFALDVALGVGGLPKGRVVEIYGPEASGKTTLALHVIAEAQKQGGTCVFVDAEHALDSSLAKAIGVNTENLLLSQPDCGEQALSLVDTLIRSGSVDVIVVDSVAALVPKGELEGEMGDAHMAMQARLMSQALRKLSHSLSLSQTLLIFINQVRSKLSTFGGFGGPTEVTCGGNALKFYASMRLNIKRIGLIKKGEETTGSQVSVKIVKNKLAPPFRTAQFELEFGKGICKITEIIDLSIKHKFIAKNGTFYNLNGKNYHGKEALKRFLKQNESDQEELMKKLQDKLIADEAADKETESESEEEDSLRVVVSPDNTDDESPALVVGAAAVVVEAA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
50	Phosphorylation	SKSDGNGSSEEGMSK CCCCCCCCCCCHHCH	38.28	25561503
51	Phosphorylation	KSDGNGSSEEGMSKK CCCCCCCCCCHHCHH	40.85	25561503
392	Phosphorylation	DEAADKETESESEEE HHHCCCCCCCCCCCC	51.02	23776212
394	Phosphorylation	AADKETESESEEEDS HCCCCCCCCCCCCCC	54.57	30291188
396	Phosphorylation	DKETESESEEEDSLR CCCCCCCCCCCCCEE	60.63	23776212
401	Phosphorylation	SESEEEDSLRVVVSP CCCCCCCCEEEEECC	22.73	23776212
415	Phosphorylation	PDNTDDESPALVVGA CCCCCCCCCHHHEEE	23.59	27531888

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RECA3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RECA3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RECA3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RECA3_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RECA3_ARATH

Related Literatures of Post-Translational Modification