| UniProt ID | CP19A_ARATH | |
|---|---|---|
| UniProt AC | Q38900 | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase CYP19-1 | |
| Gene Name | CYP19-1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 173 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Involved in reactive oxygen species production in response to pathogen infection.. | |
| Protein Sequence | MATNPKVYFDMTVGGKSAGRIVMELYADTTPETAENFRALCTGERGIGKQGKPLHYKGSSFHRVIPKFMCQGGDFTAGNGTGGESIYGSKFKDENFIKKHTGPGILSMANAGANTNGSQFFICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTSKPVVIADCGQIS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Sulfoxidation | NPKVYFDMTVGGKSA CCEEEEEEECCCCCC | 2.04 | 25693801 | |
| 23 | Sulfoxidation | KSAGRIVMELYADTT CCCCEEEEEEECCCC | 2.46 | 23289948 | |
| 42 (in isoform 2) | Phosphorylation | - | 42.82 | 29654922 | |
| 60 | Phosphorylation | PLHYKGSSFHRVIPK CCCCCCCCHHHEECC | 33.47 | 27531888 | |
| 76 | Phosphorylation | MCQGGDFTAGNGTGG EEECCCCCCCCCCCC | 38.09 | 19880383 | |
| 89 | Phosphorylation | GGESIYGSKFKDENF CCCCCCCCCCCCCCC | 20.25 | 24243849 | |
| 140 | Sumoylation | KHVVFGQVVEGLNVV CCEEEEEEEECCEEE | 4.30 | - | |
| 161 | Phosphorylation | GSDSGRTSKPVVIAD CCCCCCCCCCEEEEE | 33.33 | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CP19A_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CP19A_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CP19A_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CP19A_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
