DNAJ2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DNAJ2_ARATH
• UniProt AC: P42825
• Protein Name: Chaperone protein dnaJ 2
• Gene Name: ATJ2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 419
• Subcellular Localization: Membrane ; Lipid-anchor .
• Protein Description: Have a continuous role in plant development probably in the structural organization of compartments..
• Protein Sequence: MFGRGPSRKSDNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGSGGHPFGSHSRGRRQRRGEDVVHPLKVSLEDVYLGTTKKLSLSRKALCSKCNGKGSKSGASMKCGGCQGSGMKISIRQFGPGMMQQVQHACNDCKGTGETINDRDRCPQCKGEKVVSEKKVLEVNVEKGMQHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGEDLFVEHTISLTEALCGFQFVLTHLDKRQLLIKSKPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPESLSPDQTKAIEAVLPKPTKAAISDMEIDDCEETTLHDVNIEDEMKRKAQAQREAYDDDEEDHPGGAQRVQCAQQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
71	Phosphorylation	DPEKREIYDQYGEDA CHHHHHHHHHHCHHH	7.70	19880383
102	Phosphorylation	IFSSFFGSGGHPFGS HHHHHHCCCCCCCCC	36.12	27643528
109	Phosphorylation	SGGHPFGSHSRGRRQ CCCCCCCCCCCCCCC	20.76	27643528
111	Phosphorylation	GHPFGSHSRGRRQRR CCCCCCCCCCCCCCC	37.82	27643528
238	Phosphorylation	MQHNQKITFSGQADE CCCCCEEEEEECCCC	20.84	25368622
240	Phosphorylation	HNQKITFSGQADEAP CCCEEEEEECCCCCC	22.73	25368622
249	Phosphorylation	QADEAPDTVTGDIVF CCCCCCCCCCCEEEE	20.93	25368622
251	Phosphorylation	DEAPDTVTGDIVFVI CCCCCCCCCEEEEEE	31.09	25368622
416	Farnesylation	GGAQRVQCAQQ---- CCHHHHHCCCC----	3.18	10873538
416	Methylation	GGAQRVQCAQQ---- CCHHHHHCCCC----	3.18	-
416	Farnesylation	GGAQRVQCAQQ---- CCHHHHHCCCC----	3.18	10873538

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DNAJ2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DNAJ2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DNAJ2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of DNAJ2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.