UniProt ID | DNAJ2_ARATH | |
---|---|---|
UniProt AC | P42825 | |
Protein Name | Chaperone protein dnaJ 2 | |
Gene Name | ATJ2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 419 | |
Subcellular Localization |
Membrane Lipid-anchor . |
|
Protein Description | Have a continuous role in plant development probably in the structural organization of compartments.. | |
Protein Sequence | MFGRGPSRKSDNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGSGGHPFGSHSRGRRQRRGEDVVHPLKVSLEDVYLGTTKKLSLSRKALCSKCNGKGSKSGASMKCGGCQGSGMKISIRQFGPGMMQQVQHACNDCKGTGETINDRDRCPQCKGEKVVSEKKVLEVNVEKGMQHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGEDLFVEHTISLTEALCGFQFVLTHLDKRQLLIKSKPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPESLSPDQTKAIEAVLPKPTKAAISDMEIDDCEETTLHDVNIEDEMKRKAQAQREAYDDDEEDHPGGAQRVQCAQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
71 | Phosphorylation | DPEKREIYDQYGEDA CHHHHHHHHHHCHHH | 7.70 | 19880383 | |
102 | Phosphorylation | IFSSFFGSGGHPFGS HHHHHHCCCCCCCCC | 36.12 | 27643528 | |
109 | Phosphorylation | SGGHPFGSHSRGRRQ CCCCCCCCCCCCCCC | 20.76 | 27643528 | |
111 | Phosphorylation | GHPFGSHSRGRRQRR CCCCCCCCCCCCCCC | 37.82 | 27643528 | |
238 | Phosphorylation | MQHNQKITFSGQADE CCCCCEEEEEECCCC | 20.84 | 25368622 | |
240 | Phosphorylation | HNQKITFSGQADEAP CCCEEEEEECCCCCC | 22.73 | 25368622 | |
249 | Phosphorylation | QADEAPDTVTGDIVF CCCCCCCCCCCEEEE | 20.93 | 25368622 | |
251 | Phosphorylation | DEAPDTVTGDIVFVI CCCCCCCCCEEEEEE | 31.09 | 25368622 | |
416 | Farnesylation | GGAQRVQCAQQ---- CCHHHHHCCCC---- | 3.18 | 10873538 | |
416 | Methylation | GGAQRVQCAQQ---- CCHHHHHCCCC---- | 3.18 | - | |
416 | Farnesylation | GGAQRVQCAQQ---- CCHHHHHCCCC---- | 3.18 | 10873538 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DNAJ2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DNAJ2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DNAJ2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DNAJ2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...