dbPTM

1A111_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	1A111_ARATH
UniProt AC	Q9S9U6
Protein Name	1-aminocyclopropane-1-carboxylate synthase 11
Gene Name	ACS11
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	460
Subcellular Localization
Protein Description	1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes catalyze the conversion of S-adenosyl-L-methionine (SAM) into 1-aminocyclopropane-1-carboxylate (ACC), a direct precursor of ethylene..
Protein Sequence	MLSSKVVGDSHGQDSSYFLGWQEYEKNPFHESFNTSGIVQMGLAENQLSFDLIEKWLEEHPEVLGLKKNDESVFRQLALFQDYHGLPAFKDAMAKFMGKIRENKVKFDTNKMVLTAGSTSANETLMFCLANPGDAFLIPAPYYPGFDRDLKWRTGVEIVPIHCVSSNGYKITEDALEDAYERALKHNLNVKGVLITNPSNPLGTSTTREELDLLLTFTSTKKIHMVSDEIYSGTVFDSPEFTSVLEVAKDKNMGLDGKIHVVYSLSKDLGLPGFRVGLIYSNNEKVVSAATKMSSFGLISSQTQHLLANLLSDERFTTNYLEENKKRLRERKDRLVSGLKEAGISCLKSNAGLFCWVDLRHLLKSNTFEAEHSLWTKIVCEVGLNISPGSSCHCDEPGWFRVCFANMSDQTMEVAMDRVKGFVDNNNGGKQKRTMWDTRRRSLINKWVSKLSSVTCESER

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Phosphorylation	FHESFNTSGIVQMGL CCHHCCCCCHHHHCC	27.85	28011693
199	Phosphorylation	GVLITNPSNPLGTST EEEEECCCCCCCCCC	53.82	28295753
204	Phosphorylation	NPSNPLGTSTTREEL CCCCCCCCCCCHHHH	30.50	28295753
205	Phosphorylation	PSNPLGTSTTREELD CCCCCCCCCCHHHHH	26.44	28295753
206	Phosphorylation	SNPLGTSTTREELDL CCCCCCCCCHHHHHH	29.70	28295753
267	N6-(pyridoxal phosphate)lysine	HVVYSLSKDLGLPGF EEEEEECCCCCCCCE	63.37	-
267	Other	HVVYSLSKDLGLPGF EEEEEECCCCCCCCE	63.37	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of 1A111_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of 1A111_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of 1A111_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of 1A111_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of 1A111_ARATH

Related Literatures of Post-Translational Modification