dbPTM

GSA2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GSA2_ARATH
UniProt AC	Q42522
Protein Name	Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic
Gene Name	GSA2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	472
Subcellular Localization	Plastid, chloroplast.
Protein Description	Transaminase converting glutamate 1-semialdehyde (GSA) to 5-aminolevulinate (ALA). Involved in the biosynthesis of tetrapyrroles (By similarity)..
Protein Sequence	MAATLTGSGIALGFSCSAKFSKRASSSSNRRCIKMSVSVEEKTKKFTLQKSEEAFNAAKNLMPGGVNSPVRAFKSVGGQPVVMDSAKGSRIRDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGKQKFIKFEGCYHGHANSFLVKAGSGVATLGLPDSPGVPKAATSDTLTAPYNDIAAVEKLFEANKGEIAAIILEPVVGNSGFITPKPEFIEGIRRITKDNGALLIFDEVMTGFRLAYGGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLSQPGTYEYLDKITKELTNGILEAGKKTGHAMCGGYISGMFGFFFTEGPVYDFSDAKKSDTEKFGKFFRGMLEEGVYLAPSQFEAGFTSLAHTSEDIQFTIAAAEKVLSRL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Phosphorylation	NRRCIKMSVSVEEKT CCEEEEEEEEHHHHH	13.26	28011693
38	Phosphorylation	RCIKMSVSVEEKTKK EEEEEEEEHHHHHCC	19.26	28011693
62	Sulfoxidation	FNAAKNLMPGGVNSP HHHHHHCCCCCCCCC	3.97	25693801
83	Sulfoxidation	VGGQPVVMDSAKGSR CCCEEEEEECCCCCC	3.24	25693801
202	Phosphorylation	SFLVKAGSGVATLGL EEEEEECCCEEECCC	34.65	30291188
312	N6-(pyridoxal phosphate)lysine	PDLTTLGKIIGGGLP CCCCHHHHHHCCCCC	33.97	-
312	Other	PDLTTLGKIIGGGLP CCCCHHHHHHCCCCC	33.97	-
379	Phosphorylation	DKITKELTNGILEAG HHHHHHHHHHHHHCH	32.27	22092075

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GSA2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GSA2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GSA2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of GSA2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GSA2_ARATH

Related Literatures of Post-Translational Modification