ACT2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ACT2_ARATH
• UniProt AC: Q96292
• Protein Name: Actin-2
• Gene Name: ACT2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 377
• Subcellular Localization: Cytoplasm, cytoskeleton.
• Protein Description: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Essential component of cell cytoskeleton; plays an important role in cytoplasmic streaming, cell shape determination, cell division, organelle movement and extension growth. This is considered as one of the vegetative actins..
• Protein Sequence: MAEADDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTERGYMFTTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAEADDIQP ------CCCCCCCCC	22.23	22223895
62	Phosphorylation	YVGDEAQSKRGILTL CCCCHHHHCCCEEEE	31.22	30407730
143	Phosphorylation	VAIQAVLSLYASGRT HHHHHHHHHHHCCCC	16.85	29797451
325	Phosphorylation	EITALAPSSMKIKVV HHHHCCCCCCEEEEE	37.14	25561503
326	Phosphorylation	ITALAPSSMKIKVVA HHHCCCCCCEEEEEC	24.04	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ACT2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ACT2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ACT2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ACT12_ARATH	ACT12	physical	21798944
ADF3_ARATH	ADF3	physical	21798944
HIBC1_ARATH	CHY1	physical	21798944
FIMB1_ARATH	FIM1	physical	21481030

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.