UniProt ID | ACT2_ARATH | |
---|---|---|
UniProt AC | Q96292 | |
Protein Name | Actin-2 | |
Gene Name | ACT2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 377 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Essential component of cell cytoskeleton; plays an important role in cytoplasmic streaming, cell shape determination, cell division, organelle movement and extension growth. This is considered as one of the vegetative actins.. | |
Protein Sequence | MAEADDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTERGYMFTTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAEADDIQP ------CCCCCCCCC | 22.23 | 22223895 | |
62 | Phosphorylation | YVGDEAQSKRGILTL CCCCHHHHCCCEEEE | 31.22 | 30407730 | |
143 | Phosphorylation | VAIQAVLSLYASGRT HHHHHHHHHHHCCCC | 16.85 | 29797451 | |
325 | Phosphorylation | EITALAPSSMKIKVV HHHHCCCCCCEEEEE | 37.14 | 25561503 | |
326 | Phosphorylation | ITALAPSSMKIKVVA HHHCCCCCCEEEEEC | 24.04 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACT2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACT2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACT2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ACT12_ARATH | ACT12 | physical | 21798944 | |
ADF3_ARATH | ADF3 | physical | 21798944 | |
HIBC1_ARATH | CHY1 | physical | 21798944 | |
FIMB1_ARATH | FIM1 | physical | 21481030 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...